KEGG   Homo sapiens (human): 80352Help
Entry
80352             CDS       T01001                                 

Gene name
RNF39, HZF, HZFW, LIRF
Definition
(RefSeq) ring finger protein 39
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PRY zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_2 SPRY zf-C3HC4_3 zf-RING_6 zf-4CXXC_R1 zf-Nse
Motif
Other DBs
NCBI-GeneID: 80352
NCBI-ProteinID: NP_079512
OMIM: 607524
HGNC: 18064
Ensembl: ENSG00000204618
Vega: OTTHUMG00000031288
Pharos: Q9H2S5(Tdark)
UniProt: Q9H2S5 Q96QB5
Position
6p22.1
AA seq 420 aa AA seqDB search
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagagatttgacgagactgagactctggttgaagagagaggcaatcccagga
gaggggcggaaagcggcaaaagttaatgcgggagtcggagagaagggcatctacacagca
agcagcaggggcggcccgccatctgcgcgctcgaaggcggtcacggtggtcgcggaaggg
gcggcgtccagatcctggctttccatggatgcgcccgagctgggcccggggctggtggag
cgtctggagcagctggcgacgtgtcctctgtgcgggggctccttcgaggacccggtgctt
ctggcgtgcgagcacagcttctgccgcgcgtgtctggcccgccgctgggggactccgccg
gcgaccggcaccgaggcttcccccaccgcctgtccctgctgcggcctgccgtgtccccgc
cgcagcctgaggtctaatgtgcggctggcggtggaggtgcgaatcagccgcgagctgcga
gagaagctggctgagcctggggcccgtgcggggagacgccgaggggggcgcatccccacc
atgggctgcctggacctgcccggagaggatatgaggaagacatggagacgatttgaagtc
ccaacatccaagtcatctaattcagaggatgatctccctgaagattatccagtggtcaaa
aaaatgcttcatagactgacagccgacctgaccctggaccctgggaccgcacaccgccgc
ctgctcatctccgccgaccgccgcagcgtacaactggccccaccagggacgcccgcgccc
cctgacggccccaagcgcttcgatcagctcccagctgtgctgggtgcgcagggcttcggg
gccggccgccactgctgggaggtggagactgcggacgccgcctcctgcagagactcttct
ggggaggatgcggacgacgaggagagccactatgcagtgggcgcggccggggaatcagtg
caacgcaagggctgcgtaaggctgtgccctgcgggggccgtgtgggccgtggagggccgc
ggcggccgcctgtgggccctcacggcacccgaacccaccctgctgggcggtgttgagccc
ccgccgcggcgcattcgcgtggacctggactgggagcggggccgcgtggccttctacgac
ggccgctcactcgacctgctttacgccttccaggcgcctggccccctgggggagcgcatc
ttcccgctgttctgcacctgcgaccctcgtgctccgctccgcattgtaccagcggaaagc
tga

DBGET integrated database retrieval system