KEGG   Homo sapiens (human): 80381
Entry
80381             CDS       T01001                                 
Symbol
CD276, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2
Name
(RefSeq) CD276 molecule
  KO
K06746  immune costimulatory protein B7-H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Drug target
Enoblituzumab: D11752
Mirzotamab: D12154
Omburtamab: D11515
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    80381 (CD276)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    80381 (CD276)
CD molecules [BR:hsa04090]
 Proteins
  80381 (CD276)
SSDB
Motif
Pfam: Ig_3 ig V-set I-set Ig_2 C2-set_2 C1-set
Other DBs
NCBI-GeneID: 80381
NCBI-ProteinID: NP_001019907
OMIM: 605715
HGNC: 19137
Ensembl: ENSG00000103855
Pharos: Q5ZPR3(Tbio)
UniProt: Q5ZPR3
Position
15:73683944..73714514
AA seq 534 aa
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgctgcgtcggcggggcagccctggcatgggtgtgcatgtgggtgcagccctgggagca
ctgtggttctgcctcacaggagccctggaggtccaggtccctgaagacccagtggtggca
ctggtgggcaccgatgccaccctgtgctgctccttctcccctgagcctggcttcagcctg
gcacagctcaacctcatctggcagctgacagataccaaacagctggtgcacagctttgct
gagggccaggaccagggcagcgcctatgccaaccgcacggccctcttcccggacctgctg
gcacagggcaacgcatccctgaggctgcagcgcgtgcgtgtggcggacgagggcagcttc
acctgcttcgtgagcatccgggatttcggcagcgctgccgtcagcctgcaggtggccgct
ccctactcgaagcccagcatgaccctggagcccaacaaggacctgcggccaggggacacg
gtgaccatcacgtgctccagctaccagggctaccctgaggctgaggtgttctggcaggat
gggcagggtgtgcccctgactggcaacgtgaccacgtcgcagatggccaacgagcagggc
ttgtttgatgtgcacagcatcctgcgggtggtgctgggtgcaaatggcacctacagctgc
ctggtgcgcaaccccgtgctgcagcaggatgcgcacagctctgtcaccatcacaccccag
agaagccccacaggagccgtggaggtccaggtccctgaggacccggtggtggccctagtg
ggcaccgatgccaccctgcgctgctccttctcccccgagcctggcttcagcctggcacag
ctcaacctcatctggcagctgacagacaccaaacagctggtgcacagtttcaccgaaggc
cgggaccagggcagcgcctatgccaaccgcacggccctcttcccggacctgctggcacaa
ggcaatgcatccctgaggctgcagcgcgtgcgtgtggcggacgagggcagcttcacctgc
ttcgtgagcatccgggatttcggcagcgctgccgtcagcctgcaggtggccgctccctac
tcgaagcccagcatgaccctggagcccaacaaggacctgcggccaggggacacggtgacc
atcacgtgctccagctaccggggctaccctgaggctgaggtgttctggcaggatgggcag
ggtgtgcccctgactggcaacgtgaccacgtcgcagatggccaacgagcagggcttgttt
gatgtgcacagcgtcctgcgggtggtgctgggtgcgaatggcacctacagctgcctggtg
cgcaaccccgtgctgcagcaggatgcgcacggctctgtcaccatcacagggcagcctatg
acattccccccagaggccctgtgggtgaccgtggggctgtctgtctgtctcattgcactg
ctggtggccctggctttcgtgtgctggagaaagatcaaacagagctgtgaggaggagaat
gcaggagctgaggaccaggatggggagggagaaggctccaagacagccctgcagcctctg
aaacactctgacagcaaagaagatgatggacaagaaatagcctga

DBGET integrated database retrieval system