KEGG   Homo sapiens (human): 8048
Entry
8048              CDS       T01001                                 

Gene name
CSRP3, CLP, CMD1M, CMH12, CRP3, LMO4, MLP
Definition
(RefSeq) cysteine and glycine rich protein 3
  KO
K09377  cysteine and glycine-rich protein
Organism
hsa  Homo sapiens (human)
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8048 (CSRP3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region, LIM-only transcription (co-)factors
    8048 (CSRP3)
SSDB
Motif
Pfam: LIM Zn_ribbon_2 DUF3718 zf-ACC zf_UBZ
Other DBs
NCBI-GeneID: 8048
NCBI-ProteinID: NP_003467
OMIM: 600824
HGNC: 2472
Ensembl: ENSG00000129170
Vega: OTTHUMG00000166100
Pharos: P50461(Tbio)
UniProt: P50461 A2TDB8
Structure
PDB: 
2O10 2O13

Position
11p15.1
AA seq 194 aa
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTQQVEKKE
NT seq 585 nt   +upstreamnt  +downstreamnt
atgccaaactggggcggaggcgcaaaatgtggagcctgtgaaaagaccgtctaccatgca
gaagaaatccagtgcaatggaaggagtttccacaagacgtgtttccactgcatggcctgc
aggaaggctcttgacagcacgacagtcgcggctcatgagtcggagatctactgcaaggtg
tgctatgggcgcagatatggccccaaagggatcgggtatggacaaggcgctggctgtctc
agcacagacacgggcgagcatctcggcctgcagttccaacagtccccaaagccggcacgc
tcagttaccaccagcaacccttccaaattcactgcgaagtttggagagtccgagaagtgc
cctcgatgtggcaagtcagtctatgctgctgagaaggttatgggaggtggcaagccttgg
cacaagacctgtttccgctgtgccatctgtgggaagagtctggagtccacaaatgtcact
gacaaagatggggaactttattgcaaagtttgctatgccaaaaattttggccccacgggt
attgggtttggaggccttacacaacaagtggaaaagaaagaatga

DBGET integrated database retrieval system