KEGG   Homo sapiens (human): 8050
Entry
8050              CDS       T01001                                 

Gene name
PDHX, DLDBP, E3BP, OPDX, PDHXD, PDX1, proX
Definition
(RefSeq) pyruvate dehydrogenase complex component X
  KO
K13997  dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H02003  Pyruvate dehydrogenase E3-binding protein deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8050 (PDHX)
   00020 Citrate cycle (TCA cycle)
    8050 (PDHX)
   00620 Pyruvate metabolism
    8050 (PDHX)
  09112 Not included in regular maps
   09113 Global maps only
    8050 (PDHX)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 8050
NCBI-ProteinID: NP_003468
OMIM: 608769
HGNC: 21350
Ensembl: ENSG00000110435
Vega: OTTHUMG00000166491
Pharos: O00330(Tbio)
UniProt: O00330
Structure
PDB: 
2F60 2F5Z 1ZY8 6H60 2DNC

Position
11p13
AA seq 501 aa
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKIL
MPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSK
NIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTL
RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTAT
PTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPH
AYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPF
IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDD
ELATRFLKSFKANLENPIRLA
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcggcctcctggaggctgggctgtgatccgcggctgctgcgttatcttgtgggcttc
cccggccgccgaagcgtagggctggtgaagggggctcttgggtggtctgtaagccgcgga
gctaattggagatggtttcacagcacgcagtggcttcggggtgatcccattaagatacta
atgccatcactgtctcctacaatggaagaaggaaacattgtgaaatggctgaaaaaggaa
ggtgaagcggtgagtgctggagatgcattatgtgaaattgagactgacaaagctgtggtt
accttagatgcaagtgatgatggaatcttggccaaaatcgtggttgaagaaggaagtaaa
aatatacggctaggttcactaattggtttgatagtagaagaaggagaagattggaaacat
gttgaaattcccaaagacgtaggtcctccaccaccagtttcaaaaccttcagagcctcgc
ccctcaccagaaccacagatttccatccctgtcaagaaggaacacatacccgggacacta
cggttccgtttaagtccagctgcccgcaatattctggaaaaacactcactggatgctagc
cagggcacagccactggccctcgggggatattcactaaagaggatgctctcaaacttgtc
cagttgaaacaaacgggcaagattaccgagtccagaccaactccagcccccacagccact
cccacagcaccttcgcccctacaggccacagctggaccatcttatccccggcctgtgatc
ccaccagtatcaactcctggacaacccaatgcagtgggcacattcactgaaatccccgcc
agcaatattcgaagagttattgccaagagattaactgaatctaaaagtactgtacctcat
gcatatgctactgctgactgtgaccttggagctgttttaaaagttaggcaagatctggtc
aaagatgacattaaagtatcagtaaatgattttatcatcaaggcagcagctgttaccctt
aaacaaatgccagatgttaatgtaagctgggatggagagggcccaaagcaactgccattt
attgacatttcagtggctgtggcaacagataaaggcttacttactccaatcataaaagat
gctgctgctaaaggtatccaggaaattgctgactctgtaaaggctctatcaaagaaagca
agagatggaaaattgttgcctgaagaataccaaggaggatcttttagtatttccaacttg
gggatgtttggcatcgacgaatttactgcagtgattaaccctcctcaggcctgcattttg
gcggttgggaggttccgacctgtgctgaagctcactgaggatgaagagggaaatgccaaa
ctgcagcagcgccagctcataacagtcacaatgtcaagtgacagtcgagtggttgatgac
gaactggcaaccaggtttcttaaaagttttaaagcaaacctagagaatcctatccgactt
gcctag

DBGET integrated database retrieval system