KEGG   Homo sapiens (human): 8050Help
Entry
8050              CDS       T01001                                 

Gene name
PDHX, DLDBP, E3BP, OPDX, PDHXD, PDX1, proX
Definition
(RefSeq) pyruvate dehydrogenase complex component X
  KO
K13997  dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H02003  Pyruvate dehydrogenase E3-binding protein deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8050 (PDHX)
   00020 Citrate cycle (TCA cycle)
    8050 (PDHX)
   00620 Pyruvate metabolism
    8050 (PDHX)
  09112 Not included in regular maps
   09113 Global maps only
    8050 (PDHX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 8050
NCBI-ProteinID: NP_003468
OMIM: 608769
HGNC: 21350
Ensembl: ENSG00000110435
Vega: OTTHUMG00000166491
Pharos: O00330(Tbio)
UniProt: O00330
Structure
PDB: 

Position
11p13
AA seq 501 aa AA seqDB search
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKIL
MPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSK
NIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTL
RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTAT
PTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPH
AYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPF
IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDD
ELATRFLKSFKANLENPIRLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcctggaggctgggctgtgatccgcggctgctgcgttatcttgtgggcttc
cccggccgccgaagcgtagggctggtgaagggggctcttgggtggtctgtaagccgcgga
gctaattggagatggtttcacagcacgcagtggcttcggggtgatcccattaagatacta
atgccatcactgtctcctacaatggaagaaggaaacattgtgaaatggctgaaaaaggaa
ggtgaagcggtgagtgctggagatgcattatgtgaaattgagactgacaaagctgtggtt
accttagatgcaagtgatgatggaatcttggccaaaatcgtggttgaagaaggaagtaaa
aatatacggctaggttcactaattggtttgatagtagaagaaggagaagattggaaacat
gttgaaattcccaaagacgtaggtcctccaccaccagtttcaaaaccttcagagcctcgc
ccctcaccagaaccacagatttccatccctgtcaagaaggaacacatacccgggacacta
cggttccgtttaagtccagctgcccgcaatattctggaaaaacactcactggatgctagc
cagggcacagccactggccctcgggggatattcactaaagaggatgctctcaaacttgtc
cagttgaaacaaacgggcaagattaccgagtccagaccaactccagcccccacagccact
cccacagcaccttcgcccctacaggccacagctggaccatcttatccccggcctgtgatc
ccaccagtatcaactcctggacaacccaatgcagtgggcacattcactgaaatccccgcc
agcaatattcgaagagttattgccaagagattaactgaatctaaaagtactgtacctcat
gcatatgctactgctgactgtgaccttggagctgttttaaaagttaggcaagatctggtc
aaagatgacattaaagtatcagtaaatgattttatcatcaaggcagcagctgttaccctt
aaacaaatgccagatgttaatgtaagctgggatggagagggcccaaagcaactgccattt
attgacatttcagtggctgtggcaacagataaaggcttacttactccaatcataaaagat
gctgctgctaaaggtatccaggaaattgctgactctgtaaaggctctatcaaagaaagca
agagatggaaaattgttgcctgaagaataccaaggaggatcttttagtatttccaacttg
gggatgtttggcatcgacgaatttactgcagtgattaaccctcctcaggcctgcattttg
gcggttgggaggttccgacctgtgctgaagctcactgaggatgaagagggaaatgccaaa
ctgcagcagcgccagctcataacagtcacaatgtcaagtgacagtcgagtggttgatgac
gaactggcaaccaggtttcttaaaagttttaaagcaaacctagagaatcctatccgactt
gcctag

DBGET integrated database retrieval system