KEGG   Homo sapiens (human): 8065Help
Entry
8065              CDS       T01001                                 

Gene name
CUL5, CUL-5, VACM-1, VACM1
Definition
(RefSeq) cullin 5
  KO
K10612  cullin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8065 (CUL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8065 (CUL5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8065 (CUL5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8065 (CUL5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Cullin
     8065 (CUL5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     8065 (CUL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 Stork_head HMD
Motif
Other DBs
NCBI-GeneID: 8065
NCBI-ProteinID: NP_003469
OMIM: 601741
HGNC: 2556
Ensembl: ENSG00000166266
Vega: OTTHUMG00000166369
Pharos: Q93034(Tbio)
UniProt: Q93034
Structure
PDB: 

Position
11q22.3
AA seq 780 aa AA seqDB search
MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAK
IHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMG
KQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGV
RESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKE
EEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM
DKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQ
DDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWL
REVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSS
EKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL
AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDF
TEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAII
QIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtctaatctgttaaagaataaaggttctcttcagtttgaagacaaatgggat
tttatgcgcccgattgttttgaagcttttacgccaggaatctgttacaaaacagcagtgg
tttgatctgttttcggatgtgcatgcagtctgtctttgggatgataaaggcccagcaaaa
attcatcaggctttaaaagaagatattcttgagtttattaagcaagcacaggcacgagta
ctgagccatcaagatgatacggctttgctaaaagcatatattgttgaatggcgaaagttc
tttacacaatgtgatattttaccaaaacctttttgtcaactagagattactttaatgggt
aaacagggcagcaataaaaaatcaaatgtggaagacagtattgttcgaaagcttatgctt
gatacatggaatgagtcaatcttttcaaacataaaaaacagactccaagatagtgcaatg
aagctggtacatgctgagagattgggagaagcttttgattctcagctggttattggagta
agagaatcctatgttaacctttgttctaatcctgaggataaacttcaaatttatagggac
aattttgagaaggcatacttggattcaacagagagattttatagaacacaagcaccctcg
tatttacaacaaaatggtgtacagaattatatgaaatatgcagatgctaaattaaaagaa
gaagaaaaacgagcactacgttatttagaaacaagacgagaatgtaactccgttgaagca
ctcatggaatgctgtgtaaatgccctggtgacatcatttaaagagactatcttagctgag
tgccaaggcatgatcaagagaaatgaaactgaaaaattacatttaatgttttcattgatg
gacaaagttcctaatggtatagagccaatgttgaaagacttggaggaacatatcattagt
gctggcctggcagatatggtagcagctgctgaaactattactactgactctgagaaatac
gttgagcagttacttacactatttaatagatttagtaaactcgtcaaagaagcttttcaa
gatgatccacgatttcttactgcaagagataaggcgtataaagcagttgttaatgatgct
accatatttaaacttgaattacctttgaagcagaagggggtgggattaaaaactcagcct
gaatcaaaatgccctgagctgcttgccaattactgtgacatgttgctaagaaaaacacca
ttaagcaaaaaactaacctctgaagagattgaagcaaagcttaaagaagtgctcttggta
cttaagtatgtacagaacaaagatgtttttatgaggtatcataaagctcatttgacacga
cgtcttatattagacatctctgccgatagtgaaattgaagaaaacatggtagagtggcta
agagaagttggtatgccagcggattatgtaaacaagcttgctagaatgtttcaggacata
aaagtatctgaagatttgaaccaagcttttaaggaaatgcacaaaaataataaattggca
ttaccagctgattcagttaatataaaaattctgaatgctggcgcctggtcaagaagttct
gagaaagtctttgtctcacttcctactgaactggaggacttgataccggaagtagaagaa
ttctacaaaaaaaatcatagtggtagaaaattacattggcatcatctcatgtcaaatgga
attataacatttaagaatgaagttggtcaatatgatttggaggtaaccacgtttcagctc
gctgtattgtttgcatggaaccaaagacccagagagaaaatcagctttgaaaatcttaag
cttgcaactgaactccctgatgctgaacttaggaggactttatggtctttagtagctttc
ccaaaactcaaacggcaagttttgttgtatgaacctcaagtcaactcacccaaagacttt
acagaaggtaccctcttctcagtgaaccaggagttcagtttaataaaaaatgcaaaggtt
cagaaaaggggtaaaatcaacttgattggacgtttgcagctcactacagaaaggatgaga
gaagaagagaatgaaggaatagttcaactacgaatactaagaacccaggaagctatcata
caaataatgaaaatgagaaagaaaattagtaatgctcagctgcagactgaattagtagaa
attttgaaaaacatgttcttgccacaaaagaaaatgataaaagagcaaatagagtggcta
atagagcacaaatacatcagaagagatgaatctgatatcaacactttcatatatatggca
taa

DBGET integrated database retrieval system