KEGG   Homo sapiens (human): 80704
Entry
80704             CDS       T01001                                 
Symbol
SLC19A3, BBGD, THMD2, THTR2, hTHTR2, thTr-2
Name
(RefSeq) solute carrier family 19 member 3
  KO
K14610  solute carrier family 19 (thiamine transporter), member 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Disease
H01231  Biotin-responsive basal ganglia disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    80704 (SLC19A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    80704 (SLC19A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC19: Folate/thiamine transporter
   80704 (SLC19A3)
SSDB
Motif
Pfam: Folate_carrier MFS_1 Cadherin_C_2
Other DBs
NCBI-GeneID: 80704
NCBI-ProteinID: NP_079519
OMIM: 606152
HGNC: 16266
Ensembl: ENSG00000135917
UniProt: Q9BZV2
Position
2:complement(227683763..227718028)
AA seq 496 aa
MDCYRTSLSSSWIYPTVILCLFGFFSMMRPSEPFLIPYLSGPDKNLTSAEITNEIFPVWT
YSYLVLLLPVFVLTDYVRYKPVIILQGISFIITWLLLLFGQGVKTMQVVEFFYGMVTAAE
VAYYAYIYSVVSPEHYQRVSGYCRSVTLAAYTAGSVLAQLLVSLANMSYFYLNVISLASV
SVAFLFSLFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILST
SGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQ
ILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGYVKVNWDLLGELALVVFSVVNAGSL
FLMHYTANIWACYAGYLIFKSSYMLLITIAVFQIAVNLNVERYALVFGINTFIALVIQTI
MTVIVVDQRGLNLPVSIQFLVYGSYFAVIAGIFLMRSMYITYSTKSQKDVQSPAPSENPD
VSHPEEESNIIMSTKL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggattgttacagaacttcactaagcagttcctggatttaccccactgtgatcctctgc
ttatttggttttttctccatgatgagaccctcagaaccattccttatcccatatttatct
ggaccagataaaaacctgaccagtgcagagataacaaatgagatcttccccgtttggaca
tactcctacctggtgctgctgctgcctgtgtttgtcctcaccgattatgtccgctacaag
ccagtcatcatcttgcaaggtatcagtttcatcattacctggctgctgctgttgtttggc
caaggagtgaagaccatgcaggttgtagagttcttctatgggatggtcaccgccgccgag
gtggcctactacgcctacatatacagcgtggtcagccccgagcactaccagagagtgagc
ggctactgcaggagcgtcacgctggccgcctacacagcagggtcggtgctggctcaactc
ttggtatccctggcgaacatgtcgtacttttacctcaacgtcatatccttggcctctgtc
tccgtggctttccttttctcacttttcctaccaatgcccaagaaaagcatgttttttcat
gcaaaacccagcagagaaataaagaagtcatcaagcgtgaatccagtattagaggaaact
cacgaaggtgaagcaccaggctgtgaagagcagaaacccacatcagaaatactcagcact
tcagggaagctgaataagggccagctgaacagcctgaaaccaagcaatgtgactgtggac
gtttttgtgcagtggttccaagatttgaaggagtgctactcctcaaaacgtcttttctac
tggtctctatggtgggctttcgccacagcaggttttaaccaggttttgaactatgttcaa
atcctgtgggattacaaggcgccatcccaagattcttccatctataatggggccgtagaa
gctattgcaacctttggaggggctgtggctgcctttgcagtgggttatgtgaaagtcaac
tgggaccttctgggagagctggctctggtggtcttctcagttgtcaatgccggttcttta
tttctcatgcattacacagccaatatctgggcgtgctatgctggctatttgatattcaag
tccagctatatgcttcttataaccatagcagtatttcagattgcagttaatctgaatgtg
gaacgctatgccttggtatttggaatcaacacctttattgccttggtgattcagaccatc
atgactgtgattgtagtagatcagagagggctcaacttgccagtcagcattcagttttta
gtttatgggagctattttgcagtaattgctggaattttcctaatgagaagcatgtatatt
acctactcaaccaaatcccagaaggatgtacagagccctgctccaagtgagaatccagat
gtgtctcacccagaggaagagagtaatatcatcatgtcaacaaaactctaa

DBGET integrated database retrieval system