KEGG   Homo sapiens (human): 80705Help
Entry
80705             CDS       T01001                                 

Gene name
TSGA10, CEP4L, CT79, SPGF26
Definition
(RefSeq) testis specific 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GAS DUF4201 DUF1664 ERM YabA Pox_A3L
Motif
Other DBs
NCBI-GeneID: 80705
NCBI-ProteinID: NP_079520
OMIM: 607166
HGNC: 14927
Ensembl: ENSG00000135951
Vega: OTTHUMG00000130637
Pharos: Q9BZW7(Tbio)
UniProt: Q9BZW7 A0A218MIY9
Position
2q11.2
AA seq 698 aa AA seqDB search
MMRSRSKSPRRPSPTARGANCDVELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSE
RDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERD
SLRERLKIAQETAFNEKAHLEQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMK
SLARKAMDTESELGRQKAENNSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDE
KIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISG
MKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQ
FAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKA
NEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQI
STLHKSVVKMEEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRE
NELDSAHSEIELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLC
LAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHM
SSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaagtaggtctaaaagtccaagacgcccatcaccaactgcccggggtgcaaac
tgtgatgtagaacttttgaagacaacaacaagagatcgtgaagaacttaaatgcatgctg
gaaaaatatgagcgccatttggcagaaattcagggtaatgtcaaggttcttaaatctgag
agagacaagatcttccttctttatgaacaggcacaggaagaaattacccgacttcgacga
gaaatgatgaaaagctgtaagagtcctaaatcaacaacggcacatgctattctccggcga
gtggagactgaaagagatgtagcctttactgatttacgaagaatgaccacagaacgagat
agtctaagggagaggctaaagattgctcaagagacagcatttaatgagaaggctcacctg
gaacaaaggatagaggagctggagtgtacagttcataatcttgatgatgaacgtatggag
caaatgtcaaatatgactttgatgaaggaaaccataagcactgtggaaaaagaaatgaaa
tcactagcaagaaaggcaatggataccgaaagtgaacttggcagacaaaaagcagagaat
aattctttgagacttttgtatgaaaacacagaaaaagatctttctgatactcagcgacac
cttgctaagaaaaaatatgagctacagcttactcaggagaaaattatgtgcttggatgaa
aaaattgataactttacaaggcaaaatattgcacagcgagaagaaatcagcattcttggt
ggaaccctcaatgatctggctaaagaaaaggaatgcctgcaagcatgtttggataaaaaa
tctgagaatattgcatcccttggagagagtttggcaatgaaagaaaagaccatttcaggc
atgaagaatatcattgctgagatggaacaggcatcaagacagtgtactgaggccctaatt
gtgtgtgaacaagacgtttccagaatgcgtcggcaattggatgagacaaatgatgagctg
gcccagatcgccagggaaagagatatcttggctcatgacaatgacaatctccaggaacag
tttgctaaagctaaacaagaaaaccaggcactgtccaaaaaattgaatgacactcataat
gaacttaatgacataaaacagaaggttcaagatactaatttggaggttaacaagctgaag
aatatattaaagtctgaagaatctgagaaccggcaaatgatggaacaacttcgaaaagcc
aatgaagatgctgaaaactgggaaaataaagcccgtcaatcagaggcagataacaatacc
ctcaaactggaacttatcactgctgaggcagagggtaacagattaaaagaaaaagtagat
tccctcaacagagaggttgagcaacacttaaatgcagaaaggtcttacaagtcccagatt
tctaccttacataaatctgttgtaaaaatggaagaggagcttcagaaggttcagtttgaa
aaagtgtccgctcttgcagatttgtcttctactagggaactctgtattaaacttgactca
agcaaagaacttcttaatcgacagctggttgctaaagatcaagaaatagaaatgagggag
aatgagttagattctgctcattctgaaattgaactcctgaggagtcagatggcaaatgag
agaatctccatgcagaatctagaagctttgctggtggccaatcgagacaaagaatatcag
tctcagatagcacttcaagaaaaagaatctgaaattcagcttcttaaagaacacctttgt
ttggcagaaaataaaatggccatccagagtagagatgtggcccagttcagaaatgttgtc
acacaattggaagctgatttagacattaccaaaagacaactaggaacagagcgctttgaa
agggagagggccgtacaagaacttcgccgccaaaattattcaagtaatgcttatcatatg
agttctacaatgaagccaaatacaaaatgtcattcaccagaacgtgctcaccatcgatct
cctgaccgaggcctagatcgatcattagaagagaatctttgctacagagatttctga

DBGET integrated database retrieval system