KEGG   Homo sapiens (human): 80724Help
Entry
80724             CDS       T01001                                 

Gene name
ACAD10
Definition
(RefSeq) acyl-CoA dehydrogenase family member 10
  KO
K11729  acyl-CoA dehydrogenase family member 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    80724 (ACAD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APH Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HAD_2 Hydrolase EcKinase RIO1
Motif
Other DBs
NCBI-GeneID: 80724
NCBI-ProteinID: NP_079523
OMIM: 611181
HGNC: 21597
Ensembl: ENSG00000111271
Vega: OTTHUMG00000169602
Pharos: Q6JQN1(Tbio)
UniProt: Q6JQN1
Position
12q24.12
AA seq 1059 aa AA seqDB search
MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRV
AAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVD
SFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVE
SCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKE
LEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGPLELLQFDHGQSNPTY
YIRLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLCEDSSVIGTPF
YVMEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHSVDLQAVGLEDYGKQGDYIPR
QVRTWVKQYRASETSTIPAMERLIEWLPLHLPRQQRTTVVHGDFRLDNLVFHPEEPEVLA
VLDWELSTLGDPLADVAYSCLAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMG
LPPTENWNFYMAFSFFRVAAILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKE
GFRVFKEMPFTNPLTRSYHTWARPQSQWCPTGSRSYSSVPEASPAHTSRGGLVISPESLS
PPVRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPLIEDLKEKAKAEGLWNLFLPL
EADPEKKYGAGLTNVEYAHLCELMGTSLYAPEVCNCSAPDTGNMELLVRYGTEAQKARWL
IPLLEGKARSCFAMTEPQVASSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVF
MGKTDPHAPRHRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMV
LGPGRGFEIAQGRLGPGRIHHCMRLIGFSERALALMKARVKSRLAFGKPLVEQGTVLADI
AQSRVEIEQARLLVLRAAHLMDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQAFGAAGL
SSDYPLAQFFTWARALRFADGPDEVHRATVAKLELKHRI
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtcaggagctgtttccagtccccccgtctccagtgggtgtggagaacagccttc
ctgaaacacacccagcgcaggcaccaggggtcccaccgatggacacaccttggaggcagc
acctacagagcggtgattttcgacatgggcggagttctcattccttctccagggagagtc
gctgcagaatgggaggtacagaatcgtatcccttctggaactatattaaaggccttgatg
gaaggtggtgaaaatgggccctggatgagatttatgagagcagaaataacagcagagggt
tttttacgagaatttgggagactttgctctgaaatgttaaagacctccgtgcctgtggac
tcatttttctctctgttgaccagtgagcgagtggcaaagcagttcccagtgatgactgag
gccataactcaaattcgggcaaaaggtcttcagactgcagtcttgagcaataatttttat
cttcccaaccagaaaagctttttgcccctggaccggaaacagtttgatgtgattgtggag
tcctgcatggaagggatctgtaagccagaccctaggatctacaagctgtgcttggagcag
ctcggcctgcagccctctgagtccatctttcttgatgaccttggaacaaatctaaaagaa
gctgccagacttggtattcacaccattaaggttaatgacccagagactgcagtaaaggaa
ttagaagctctcttgggttttacattgagagtaggtgttccaaacactcggcctgtgaaa
aagacgatggaaattccgaaagattccttgcagaagtacctcaaagacttactgggtatc
cagaccacaggcccattggaactacttcagtttgatcacgggcagtcaaatccaacttac
tacatcaggctggctaatcgtgatctagttctgaggaagaagcccccagggacactcctt
ccatctgcccatgccatagagagggagttcaggattatgaaagcccttgcaaatgctgga
gtacctgtccctaacgttcttgatctctgtgaagattcaagtgtcattggcacccccttc
tatgtgatggagtactgcccaggtctcatctacaaagacccttccctgccaggcttggag
cccagccacagacgagccatatacactgccatgaacacagtcctgtgcaaaattcacagt
gtggatctgcaggctgtgggacttgaagactatgggaagcaaggggactatattccacgc
caggtacgaacctgggttaagcagtatcgagcttccgaaactagcaccatcccagccatg
gagaggctgatcgaatggctgcccctccatcttccccgtcagcagaggaccacagtggtg
cacggggacttcaggctcgacaacctggtgtttcatccagaagagccagaggtgcttgct
gtccttgactgggaactttctaccttgggcgacccccttgctgatgtggcctacagctgc
ctggctcattacctgccatccagttttcccgtgctgagaggtattaatgactgtgacttg
acacagctgggaatccctgctgcagaggagtatttcaggatgtactgtctccaaatgggg
ctccctcccactgagaactggaacttctatatggctttttcctttttccgtgtggctgca
atcctacagggagtctacaagcgatcactcacagggcaagcaagctccacatatgcggaa
caaactggaaagctgaccgaatttgtgtctaacctggcgtgggatttcgcagtcaaagaa
gggttccgggttttcaaagagatgcccttcacaaatccgttaacaaggtcctaccacacg
tgggccaggccccagtcccagtggtgccccacaggcagcaggagttatagctccgttcca
gaagcttccccagctcatacctcaaggggaggtctggttatctctccagagagcctctct
ccacctgtcagagagctgtatcaccggctgaagcacttcatggagcaacgtgtgtaccct
gcagagccagagctgcagagtcaccaggcctcagcagccaggtggagcccctccccactg
atcgaagacctcaaggagaaagccaaagctgaaggactttggaaccttttcctaccctta
gaggctgatcccgagaaaaaatacggagcaggactgaccaatgtggaatatgcacatctg
tgtgagctcatgggcacgtccctgtatgcccccgaggtatgtaactgctctgcgcctgac
acgggcaacatggagctgctggtgaggtatggcaccgaagcgcagaaggctcgctggctg
attcctctgctggaggggaaagcccgctcctgttttgctatgaccgagccccaggttgcc
tcttcagatgccaccaacattgaggcttccatcagagaggaggacagcttctatgtcata
aacggtcacaaatggtggatcacaggcatcctggatcctcgttgccaactctgtgtgttt
atgggaaaaacagacccacatgcaccaagacaccggcagcagtctgtgctcttggttccc
atggataccccagggataaaaatcatccggcctctgacggtgtatggactggaagatgca
ccaggtggccatggtgaagtccgatttgagcacgtgcgtgtgcccaaagagaacatggtc
ctgggccctggccgaggctttgagatcgcccagggcagactgggccccggcaggatccat
cactgcatgaggctgatcgggttctcagagagggccctggcactcatgaaggcccgcgtg
aagtcccgcttggcttttgggaagcccctggtggagcagggcacagtgctggcggacatc
gcgcagtcgcgcgtggagattgagcaggcacggctgctggtgctgagagctgcccacctc
atggacctggcaggaaacaaggctgcagccttggatatagccatgattaaaatggtcgcc
ccgtccatggcctcccgagtgattgatcgtgcgattcaggcctttggagcagcaggcctg
agcagcgactacccactggctcagttcttcacctgggcccgagccctgcgctttgccgac
ggccctgacgaggtgcaccgggccacggtggccaagctagagctgaagcaccgcatttag

DBGET integrated database retrieval system