KEGG   Homo sapiens (human): 80727
Entry
80727             CDS       T01001                                 
Symbol
TTYH3
Name
(RefSeq) tweety family member 3
  KO
K22641  protein tweety
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    80727 (TTYH3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   80727 (TTYH3)
SSDB
Motif
Pfam: Tweety Prominin DUF2721
Other DBs
NCBI-GeneID: 80727
NCBI-ProteinID: NP_079526
OMIM: 608919
HGNC: 22222
Ensembl: ENSG00000136295
UniProt: Q9C0H2 Q8WYU9
Position
7:2631986..2664802
AA seq 523 aa
MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLF
LLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATY
SLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLG
YTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILV
GVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGDILQYYLACS
PRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHL
TALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD
EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNAN
FQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggccggggtcagctacgcggcgccctggtgggtgagcctcctgcaccggctgccccac
ttcgacctgagctgggaggccactagcagccagttccggcccgaggacaccgactaccag
caggccctgctgctcctgggggccgccgccctggcctgcctcgccctggacctcctcttc
ctgctcttctactccttctggctgtgctgccggcggcgcaagagcgaggagcacctggac
gccgactgctgctgcacggcctggtgtgtcatcatcgccacgctggtgtgcagcgccggc
atcgcagtgggattctacggcaacggggagaccagtgatggcatccatagggccacctac
tcgctccgccacgccaaccgcacggtggccggggtccaggaccgcgtgtgggacacggcg
gtggggctgaaccacacggcggagcccagcctgcagaccctggagcggcagctggccggg
cggcccgagcccctgcgagccgtacagaggctgcagggcctgctggagacgctgctgggc
tacacggccgccatccccttttggaggaacacggcggtgtcgctggaggtgctggcggag
caggtggatctctacgactggtacaggtggctgggctacctgggcctgctgctgctggac
gtcatcatctgcctcctggtgctggttggcctcatccgcagctccaagggcatcctggtg
ggggtctgcctgctgggagtcctggccctggtcatcagctggggcgcgctgggcttggag
ctggctgtgtccgtgggctccagcgacttctgtgtggaccctgacgcctacgtgaccaaa
atggtggaggagtactcggtgctgagtggggacatcctgcagtactacctggcctgctcg
ccccgcgccgccaaccccttccagcagaagctgtcgggcagccacaaggcactggtggag
atgcaggatgtcgtggctgagcttctgaggaccgtcccctgggagcagccggccactaag
gaccccctcctccgcgtccaggaggtgctgaatggcacggaggtgaacctgcagcacctc
accgccctggtggactgccgcagcctgcatctggactacgtgcaagcgctgaccggcttc
tgctatgacggcgtggagggcctcatctacctggccctcttctccttcgtcacagccctc
atgttcagctccatcgtctgcagcgtcccgcacacctggcagcaaaagagaggccctgat
gaggacggggaggaggaggccgctccagggccgcggcaggcgcacgacagcctctaccgc
gtccacatgcccagcctgtacagctgtggcagcagctacggcagtgagaccagcatcccg
gccgcggcccacaccgtcagcaacgccccggtcactgagtacatgagccagaacgctaat
ttccagaacccccgctgtgagaacaccccactcattgggcgcgagtccccgccgccctca
tacacctccagcatgagagccaaatacctcgccacgagccagcctcgccctgactccagc
ggcagccactag

DBGET integrated database retrieval system