KEGG   Homo sapiens (human): 80728Help
Entry
80728             CDS       T01001                                 

Gene name
ARHGAP39, CrGAP, Vilse
Definition
(RefSeq) Rho GTPase activating protein 39
  KO
K20649  Rho GTPase-activating protein 39
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80728 (ARHGAP39)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    80728 (ARHGAP39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP MyTH4 WW
Motif
Other DBs
NCBI-GeneID: 80728
NCBI-ProteinID: NP_001295136
OMIM: 615880
HGNC: 29351
Ensembl: ENSG00000147799
Vega: OTTHUMG00000165182
Pharos: Q9C0H5(Tbio)
UniProt: Q9C0H5
Position
8q24.3
AA seq 1083 aa AA seqDB search
MSQTQDYECRSHNVDLPESRIPGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASA
ESSPGRGSSVSREGSTSSSLEPEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLE
KDYEIYRDYSADGQLLHYRTSSLRWNSGAKERMLIKVADREPSFLAAQGNGYAPDGPPGV
RSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQ
PSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPN
KQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAP
NPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQD
TLSSTGYSPGTRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAE
GEAEGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVV
RAFSEDEALAQQENRHWRRGTFEKLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLAAC
AQFESSRQSRSGVPSSSCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANML
AWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGL
RDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTK
GVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEVMGMQR
ERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTGLEDPH
VPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLIRFLQV
FVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHLDTSFME
GVL
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacgcaggactacgagtgcaggagccataatgtcgacctgccggagtcgagg
attccagggtcgaacactcggttggagtgggtggagatcatcgaaccgcgcacccgcgag
cgcatgtacgccaacctggtcaccggtgagtgcgtgtgggacccgccggccggcgtccgc
atcaagcgcaccagcgagaaccagtggtgggagctgttcgaccccaacacgtcccgcttc
tactactacaatgccagcacgcagcgcacggtgtggcaccggccgcagggctgcgacatc
atcccgctggccaagctgcagacgctgaagcagaacacggagtccccgcgcgcctcggcg
gagagcagccccgggcgcggcagcagcgtcagccgtgagggcagcaccagctcctccctg
gagcccgagcccgacactgagaaagcgcaggagttgccagcgagggccgggcggcccgcg
gcgtttgggacagtgaaggaggacagcggcagctcttcaccaccaggagtgttccttgag
aaggactatgagatttaccgggattacagtgcggacggccagcttcttcactacaggacc
tcctcgctgcggtggaactcgggcgccaaagagcgcatgctcatcaaggtcgctgatcgg
gagcccagcttcctcgccgcccagggcaatggctacgccccagacggcccacctggggtc
cgctcccgcagaccctccggcagccagcactcacccagcctgcagaccttcgccccggag
gctgacggcaccatcttcttcccagagaggaggccgtcacccttcctgaagagggccgag
ctcccagggagcagctccccgctgctggcccagccccgaaagccctccggggactcgcag
ccctcctccccgcgctatggctatgaacccccgctctacgaggagcccccagtggagtac
caggcccccatctacgatgagccccccatggacgtgcaattcgaggctggcgggggctac
caggccggctctccccagcggtcgccgggccgtaagccccggccgttcctccagcccaac
aagcagggccccccctcgccctgccagcagctggtgctcaccaagcagaagtgtcccgag
cgcttcctgagcctggagtacagtcccgccggcaaggagtacgtgcggcagctggtctac
gtggagcaggcgggctccagccccaagctgcgcgccggcccgcggcacaagtacgcgccc
aaccccggcggtggttcgtactccttgcagcccagcccctgcctgctgagggaccagcgc
ctgggcgtcaagtccggagactacagcaccatggagggacctgagctgcggcacagccag
ccgcccacgccgctgccacaggcccaggaggatgccatgtcctggtccagccagcaggac
accctgtcctccacaggctactccccgggcacgcgcaagcggaagagcagaaagccctct
ttgtgccaagccaccagcgccacccccactgagggccccggggacctgcttgtggagcag
cccctggccgaggaacagcccccgtgcgggaccagcctcgcccccgtgaagcgagcggaa
ggtgaggccgaaggggcgcggggcgcggccgagcccttcctggcgcaggctcggctggcc
tgggaggcgcagcaggcccacttccacatgaagcagaggagcagctgggactcccagcag
gacggctctggctacgagagcgacggcgccctgccactgcccatgcccgggccggtggtg
cgggccttcagcgaggacgaggcgctggcccagcaggagaacaggcactggaggaggggc
accttcgagaagctaggcttcccccagatcctgctggagaagagcgtctccgtgcagacc
aacctggcctcaccagagccctacctccacccctcacagtctgaggacctcgctgcctgt
gcccagttcgagagcagccggcagagccgcagcggcgttcccagctccagctgcgtcttc
cccactttcacgctgcgcaagccctcctcggagacggacatcgagaactgggcctccaag
cacttcaacaagcacacgcagggcctcttccggcggaaggtgtccatcgccaacatgctg
gcctggagcagcgagtccatcaagaagcccatgatcgtgacaagcgaccggcacgtgaag
aaggaggcctgcgagctcttcaagctgatccagatgtacatgggtgaccggcgggccaag
gccgacccactgcacgtggccctggaggtggccaccaagggctggagcgtgcagggcctg
cgggacgagctctacatccagctgtgccggcagaccaccgagaacttccgcctggagagc
ctggcccgcggctgggagctcatggccatctgcctggcctttttcccgcccacccccaag
ttccactcctacctggaaggctacatctaccggcacatggaccccgtcaatgacactaaa
ggggtggcgataagcacgtatgccaagtactgttaccacaagctacagaaggcagccctg
accggggccaagaaggggctgaagaagcccaacgtggaggagatccggcatgccaagaac
gccgtgttcagcccgtccatgttcggcagcgcactgcaggaggtcatgggcatgcagaga
gagcgctaccccgagcgccagctgccctgggtgcagacacggctctctgaggaggtgctg
gcgctcaacggtgaccagacagagggcatcttcagggtccctggggacattgacgaggtg
aatgccctgaagctgcaggtggaccagtggaaggtgcccacaggcctggaagacccccac
gtccctgcgtccctgctgaagctgtggtaccgggagctggaggagcccctgatcccgcac
gagttctacgagcagtgcatcgcgcactacgacagccccgaggcggcggtggccgtggtg
cacgcgctgccccgcatcaaccgcatggtgctgtgctacctcatccgcttcctgcaggtc
ttcgtgcagccggccaacgtcgcggtcaccaagatggatgtcagcaacctggccatggtg
atggcgcccaactgcttgcgctgccagtccgacgacccgcgcgtcatcttcgagaacacc
cgcaaggagatgtccttcctgcgggtgctcatccagcacctggacaccagcttcatggag
ggtgtgctgtag

DBGET integrated database retrieval system