KEGG   Homo sapiens (human): 80739Help
Entry
80739             CDS       T01001                                 

Gene name
MPIG6B, C6orf25, G6b, G6b-B, NG31, THAMY
Definition
(RefSeq) megakaryocyte and platelet inhibitory receptor G6b
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: G6B
Motif
Other DBs
NCBI-GeneID: 80739
NCBI-ProteinID: NP_612116
OMIM: 606520
HGNC: 13937
Ensembl: ENSG00000204420
Vega: OTTHUMG00000031130
Pharos: O95866(Tdark)
UniProt: O95866 B0V023
Position
6p21.33
AA seq 241 aa AA seqDB search
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGR
RPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVL
HVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF
APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVV
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtttctgcagctgctaccgctgctgctctcgagggcccaagggaaccctggg
gcttctctggacggccgccctggggaccgggtgaatctctcctgcggaggagtctctcat
cccatccgctgggtctgggcacccagcttcccggcctgcaagggcctgtccaaaggacgc
cgaccgatcctgtgggcctcttcgagcgggacccccaccgtgcctcccctccagcctttc
gtcggccgcctacgctccctggactctggtatccggcggctggagctcctcttgagcgcg
ggggactcgggcacttttttctgcaagggccgccacgaggacgagagccgtacagtgctt
cacgtgctgggggacaggacctattgcaaggcccccgggcctacccatgggtccgtgtat
ccccagctcctgatcccgctgctgggcgctgggttggtgctcggactgggagctttgggc
ctggtctggtggctgcacaggcgcctgcccccgcaaccgattcgaccactccctagattt
gctccacttgtgaaaaccgagccccagaggccagtaaaggaggaagagcccaagattcca
ggggacctggaccaggaaccgagcctgctctatgcggatctggaccatctagccctcagc
aggccccgccggctgtccacagcggaccctgctgatgcctccaccatctatgcagttgta
gtttga

DBGET integrated database retrieval system