KEGG   Homo sapiens (human): 8074Help
Entry
8074              CDS       T01001                                 

Gene name
FGF23, ADHR, FGFN, HPDR2, HYPF, PHPTC
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00214  Hypophosphatemic rickets
H01193  Familial tumoral calcinosis (FTC)
H02141  Autosomal dominant hypophosphatemic rickets
Drug target
Burosumab: D10913
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8074 (FGF23)
   04015 Rap1 signaling pathway
    8074 (FGF23)
   04010 MAPK signaling pathway
    8074 (FGF23)
   04151 PI3K-Akt signaling pathway
    8074 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8074 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    8074 (FGF23)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    8074 (FGF23)
   05226 Gastric cancer
    8074 (FGF23)
   05218 Melanoma
    8074 (FGF23)
   05224 Breast cancer
    8074 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8074 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    8074 (FGF23)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   8074 (FGF23)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   8074 (FGF23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 8074
NCBI-ProteinID: NP_065689
OMIM: 605380
HGNC: 3680
Ensembl: ENSG00000118972
Vega: OTTHUMG00000168241
Pharos: Q9GZV9(Tbio)
UniProt: Q9GZV9
Structure
PDB: 

Position
12p13.32
AA seq 251 aa AA seqDB search
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgtgccttgtgcagcgtctgcagcatgagc
gtcctcagagcctatcccaatgcctccccactgctcggctccagctggggtggcctgatc
cacctgtacacagccacagccaggaacagctaccacctgcagatccacaagaatggccat
gtggatggcgcaccccatcagaccatctacagtgccctgatgatcagatcagaggatgct
ggctttgtggtgattacaggtgtgatgagcagaagatacctctgcatggatttcagaggc
aacatttttggatcacactatttcgacccggagaactgcaggttccaacaccagacgctg
gaaaacgggtacgacgtctaccactctcctcagtatcacttcctggtcagtctgggccgg
gcgaagagagccttcctgccaggcatgaacccacccccgtactcccagttcctgtcccgg
aggaacgagatccccctaattcacttcaacacccccataccacggcggcacacccggagc
gccgaggacgactcggagcgggaccccctgaacgtgctgaagccccgggcccggatgacc
ccggccccggcctcctgttcacaggagctcccgagcgccgaggacaacagcccgatggcc
agtgacccattaggggtggtcaggggcggtcgagtgaacacgcacgctgggggaacgggc
ccggaaggctgccgccccttcgccaagttcatctag

DBGET integrated database retrieval system