KEGG   Homo sapiens (human): 80758Help
Entry
80758             CDS       T01001                                 

Gene name
PRR7
Definition
(RefSeq) proline rich 7, synaptic
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: WBP-1 TMEM171 HemY_N
Motif
Other DBs
NCBI-GeneID: 80758
NCBI-ProteinID: NP_001167572
OMIM: 618306
HGNC: 28130
Ensembl: ENSG00000131188
Vega: OTTHUMG00000130861
Pharos: Q8TB68(Tbio)
UniProt: Q8TB68 A0A024R7R8
Position
5q35.3
AA seq 274 aa AA seqDB search
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLE
LEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH
ALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKI
VTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVF
PSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgtcccagggcacctacacgttcctcacgtgcttcgccggcttctggctcatc
tggggtctcatcgtcctgctctgctgcttctgcagcttcctgcgccgccgcctcaaacgg
cgccaggaggagcgactgcgcgagcagaacctgcgcgccctagagctggagcccctcgaa
ctcgagggcagtctggccgggagccccccgggcctggcgccgccgcagccaccaccacac
cgtagccgcctggaggcgccggctcacgcgcactcgcatccgcacgtgcacgtgcacccg
ctgctgcaccacgggcccgcgcagccgcacgcgcacgcgcacccacacccgcaccaccac
gcgctcccgcacccgccgcctacgcacctgtcggtgccgccacggccctggagctacccg
cgccaagcggaatcggacatgtccaaaccaccgtgttacgaagaggcggtgctgatggca
gagccgccgccgccctatagcgaggtgctcacggacacgcgcggcctctaccgcaagatc
gtcacgcccttcctgagtcgccgcgacagcgcggagaagcaggagcagccgcctcccagc
tacaagccgctcttcctggaccggggctacacctcggcgctgcacctgcccagcgcccct
cggcccgcgccgccctgcccagccctctgcctgcaggccgaccgtggccgccgggtcttc
cccagctggaccgactcagagctcagcagccgcgagcccctggagcacggagcttggcgt
ctgccggtctccatccccttgttcgggaggactacagccgtatag

DBGET integrated database retrieval system