KEGG   Homo sapiens (human): 80777
Entry
80777             CDS       T01001                                 
Symbol
CYB5B, CYB5-M, CYPB5M, OMB5
Name
(RefSeq) cytochrome b5 type B
  KO
K23490  cytochrome b5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    80777 (CYB5B)
SSDB
Motif
Pfam: Cyt-b5 MIP DUF2244
Other DBs
NCBI-GeneID: 80777
NCBI-ProteinID: NP_085056
OMIM: 611964
HGNC: 24374
Ensembl: ENSG00000103018
Pharos: O43169(Tbio)
UniProt: O43169
Structure
Position
16:69424619..69466264
AA seq 150 aa
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtccggttcaatggcgactgcggaagctagcggcagcgatgggaaagggcaggaagtc
gagacctcagtcacctattaccggttggaggaggtggcaaagcgcaactccttgaaggaa
ctgtggcttgtgatccatgggcgagtctacgatgtcacccgcttcctcaacgagcaccct
ggaggagaagaggttctgctggaacaagctggtgtagatgcaagtgaaagctttgaagat
gtaggacactcttctgatgccagagaaatgctaaagcagtactacattggtgatatccat
ccgagtgaccttaaacctgaaagtggtagcaaggacccttcaaaaaatgatacatgcaaa
agttgctgggcatattggattttacccatcataggcgctgttctcttaggtttcctgtac
cgctactacacatcggaaagcaaatcctcctga

DBGET integrated database retrieval system