KEGG   Homo sapiens (human): 8078
Entry
8078              CDS       T01001                                 

Gene name
USP5, ISOT
Definition
(RefSeq) ubiquitin specific peptidase 5
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    8078 (USP5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8078 (USP5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8078 (USP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     8078 (USP5)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   8078 (USP5)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    8078 (USP5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8078 (USP5)
SSDB
Motif
Pfam: UCH zf-UBP_var UBA zf-UBP UCH_1 UBA_4 UBA_3
Other DBs
NCBI-GeneID: 8078
NCBI-ProteinID: NP_001092006
OMIM: 601447
HGNC: 12628
Ensembl: ENSG00000111667
Vega: OTTHUMG00000169233
Pharos: P45974(Tbio)
UniProt: P45974 A0A140VJZ1
Structure
PDB: 

Position
12p13.31
AA seq 858 aa
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggtccctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacgccggagtctgag
gggggcctctacatctgtatgaacacgtttctgggctttgggaaacagtatgtggagaga
catttcaataagaccggccagcgagtctacttgcacctccggcggacccggcgcccgaaa
gaggaggaccctgctacaggcactggagacccaccccggaagaagcccacgcggctggct
attggtgttgaaggcggatttgaccttagcgaggagaagtttgaattagacgaggatgtg
aagattgtcattttgccagattacctggagattgcccgggatggactggggggactgcct
gacattgtcagagatcgggtgaccagtgcagtggaggccctactgtcggccgactcagcc
tcccgcaagcaggaggtgcaggcatgggatggggaagtacggcaggtgtctaagcatgcc
ttcagcctcaagcagttggacaaccctgctcgaatccctccctgtggctggaagtgctcc
aagtgtgacatgagagagaacctgtggctcaacctgactgatggctccatcctctgtggg
cgacgctacttcgatggcagtgggggcaacaaccacgctgtggagcactaccgagagaca
ggctacccgttagctgtcaagctgggcaccatcacccctgatggagctgacgtgtactca
tatgatgaggatgacatggtcctggaccccagcctggctgagcacctgtcccacttcggc
atcgacatgctgaagatgcagaagacagacaagacgatgactgagttggagatagacatg
aaccagcggattggtgaatgggagctgatccaggagtcaggtgtgccactcaagcccctg
tttgggcctggctacacaggcatccggaacctgggtaacagctgctacctcaactctgtg
gtccaggtgctcttcagcatccctgacttccagaggaagtatgtggataagctggagaag
atcttccagaatgccccgacggaccctacccaggatttcagcacccaggtggccaagctg
ggccatggccttctctccggggagtattccaagccagtaccggagtcgggcgatggggag
cgggtgccagaacagaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
atcggcaagggccaccctgaattctccaccaaccggcagcaggatgcccaggagttcttc
cttcaccttatcaacatggtggagaggaattgccggagctctgaaaatcctaatgaagtg
ttccgcttcttggtggaggaaaagatcaagtgcctggccacagagaaggtgaagtacacc
cagcgagttgactacatcatgcagctgcctgtgcccatggatgcagcccttaacaaagag
gagcttctggagtacgaggagaagaagcggcaagccgaagaggagaagatggcactgcca
gaactggttcgggcccaggtgcccttcagctcttgcctggaggcctacggggcccctgag
caggtcgatgacttctggagcacggccctgcaggccaagtcagtagctgtcaagaccaca
cgatttgcctcattccctgactacctggtcatccagatcaagaagttcaccttcggctta
gactgggtgcccaagaaactggatgtgtccatcgagatgccagaggagctcgacatctcc
cagttgaggggcacagggctgcagcccggagaggaggagctgccagacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcgcccatgctggatgaatcagtcatc
atccagctggtggagatgggattccctatggacgcctgccgcaaagctgtctactacacg
ggcaacagcggggctgaggccgccatgaactgggtcatgtcacacatggatgatccagat
tttgcaaaccccctcatcctgcctggctctagtgggccgggctccacaagcgcagcagcc
gacccccctcctgaggactgtgtgaccaccattgtctccatgggcttctcccgggaccag
gccttgaaagcgctgcgggccacgaacaatagtttagaacgggctgtggactggatcttc
agtcacattgacgacctggatgctgaagctgccatggacatctcagagggccgctcagct
gccgactccatctctgagtctgtgccagtgggacctaaagtccgggatggtcctggaaag
tatcagctctttgccttcattagtcacatgggcacctctaccatgtgtggtcactacgtc
tgccacatcaagaaagaaggcagatgggtgatctacaatgaccagaaagtgtgtgcctcc
gagaagccgcccaaggacctgggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system