KEGG   Homo sapiens (human): 80781Help
Entry
80781             CDS       T01001                                 

Gene name
COL18A1, KNO, KNO1, KS
Definition
(RefSeq) collagen type XVIII alpha 1 chain
  KO
K06823  collagen, type XVIII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00805  Vitreoretinal degeneration
H02074  Knobloch syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    80781 (COL18A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    80781 (COL18A1)
   00535 Proteoglycans [BR:hsa00535]
    80781 (COL18A1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    80781 (COL18A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   80781 (COL18A1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   80781 (COL18A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   80781 (COL18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endostatin Collagen DUF959 Fz Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 80781
NCBI-ProteinID: NP_569711
OMIM: 120328
HGNC: 2195
Ensembl: ENSG00000182871
Vega: OTTHUMG00000090407
Pharos: P39060(Tbio)
UniProt: P39060
Structure
PDB: 

Position
21q22.3
AA seq 1751 aa AA seqDB search
MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADT
TTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKG
IRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGA
HTTEAGTLPAPTPSPPSLGRPWAPLTGPSVPPPSSGRASLSSLLGGAPPWGSLQDPDSQG
LSPAAAAPSQQLQRPDVRLRTPLLHPLVMGSLGKHAAPSAFSSGLPGALSQVAVTTLTRD
SGAWVSHVANSVGPGLANNSALLGADPEAPAGRCLPLPPSLPVCGHLGISRFWLPNHLHH
ESGEQVRAGARAWGGLLQTHCHPFLAWFFCLLLVPPCGSVPPPAPPPCCQFCEALQDACW
SRLGGGRLPVACASLPTQEDGYCVLIGPAAERISEEVGLLQLLGDPPPQQVTQTDDPDVG
LAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKL
SGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQR
MPLARSSRGLELEPGAGLFVAQAGGADPDKFQGVIAELKVRRDPQVSPMHCLDEEGDDSD
GASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPLAGGSSTEDSRSEEVEEQTTV
ASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAGPPGSPCLPGP
PGLPCPVSPLGPAGPALQTVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTGPQGFP
GTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRG
PRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGR
EGPPGRTGQKGSLGEAGAPGHKGSKGAPGPAGARGESGLAGAPGPAGPPGPPGPPGPPGP
GLPAGFDDMEGSGGPFWSTARSADGPQGPPGLPGLKGDPGVPGLPGAKGEVGADGVPGFP
GLPGREGIAGPQGPKGDRGSRGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSV
PGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGALGPAQKGAKG
EPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPP
GPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLE
AEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGPPGPPGPRGYPGIPGPKGESIRGQPG
PPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGTMGASS
GVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVA
ALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRP
ARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSS
RLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHP
TWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVL
CIENSFMTASK
NT seq 5256 nt NT seq  +upstreamnt  +downstreamnt
atggctccctacccctgtggctgccacatcctgctgctgctcttctgctgcctggcggct
gcccgggccaacctgctgaacctgaactggctttggttcaataatgaggacaccagccat
gcagctaccacgatccctgagccccaggggcccctgcctgtgcagcccacagcagatacc
accacacacgtgaccccccggaatggttccacagagccagcgacagcccctggcagccct
gagccaccctcagagctgctggaagatggccaggacacccccacttctgccgagagcccg
gacgcgccagaggagaacattgccggtgtcggagccgagatcctgaacgtggccaaaggc
atccggagcttcgtccagctgtggaatgacactgtccccactgagagcttggccagggcg
gaaaccctggtcctggagactcctgtgggcccccttgccctcgctgggccttccagcacc
ccccaggagaatgggaccactctctggcccagccgtggcattcctagctctccgggcgcc
cacacaaccgaggctggcaccttgcctgcacccaccccatcgcctccctccctgggcagg
ccctgggcaccactcacggggccctcagtgccaccaccatcttcaggtagagcttctctc
tcctccttgctgggcggggcccctccctggggaagcctgcaggacccagacagccaagga
ctctcgcccgccgcagccgctcccagccagcagctccaacgccctgacgtccgcctgcgc
acgccacttctgcaccccctggtgatgggctccctgggcaagcacgcggccccctccgcc
ttctcctctgggctcccgggcgcactgtctcaggtcgcagtcaccactttaaccagggac
agcggtgcttgggtctcccacgtggctaactctgtggggccgggtcttgctaataactct
gccctgctcggggctgaccccgaggcccccgccggtcgctgcctgcccctgccaccctcc
ctgccagtctgcggccacctgggcatctcacgcttctggctgcccaaccacctccaccac
gagagcggcgagcaggtgcgggccggggcacgggcgtgggggggcctgctgcagacgcac
tgccaccccttcctcgcctggttcttctgcctgctgctggtccccccatgcggcagcgtc
ccgccgcccgccccgccaccctgctgccagttctgcgaggccctgcaggatgcgtgttgg
agccgcctgggcgggggccggctgcccgtcgcctgtgcctcgctcccgacccaggaggat
gggtactgtgtgctcattgggccggctgcagagcgcatcagcgaggaggtggggctgctg
cagctccttggggaccccccgccccagcaggtcacccagacggatgaccccgacgtcggg
ctggcctacgtctttgggccagatgccaacagtggccaagtggcccggtaccacttcccc
agcctcttcttccgtgacttctcactgctgttccacatccggccagccacagagggccca
ggggtgctgttcgccatcacggactcggcgcaggccatggtcttgctgggcgtgaagctc
tctggggtgcaggacgggcaccaggacatctccctgctctacacagaaccaggtgcaggc
cagacccacacagccgccagcttccggctccccgccttcgtcggccagtggacacactta
gccctcagtgtggcaggtggctttgtggccctctacgtggactgtgaggagttccagaga
atgccgcttgctcggtcctcacggggcctggagctggagcctggcgccgggctcttcgtg
gctcaggcggggggagcggaccctgacaagttccagggggtgatcgctgagctgaaggtg
cgcagggacccccaggtgagccccatgcactgcctggacgaggaaggcgatgactcagat
ggggcatccggagactctggcagcgggctcggggacgcccgggagcttctcagggaggag
acgggcgcggccctaaaacccaggctccccgcgccaccccccgtcaccacgccacccttg
gctggaggcagcagcacggaagattccagaagtgaagaagtcgaggagcagaccacggtg
gcttcgttaggagctcagacacttcctggctcagattctgtctccacgtgggacgggagt
gtccggacccctgggggccgcgtgaaagagggcggcctgaaggggcagaaaggggagcca
ggtgttccgggcccacctggccgggcaggccccccaggatccccatgcctacctggtccc
ccgggtctcccgtgcccagtgagtcccctgggtcctgcaggcccagcgttgcaaactgtc
cccggaccacaaggacccccagggcctccggggagggacggcacccctggaagggacggc
gagccgggcgaccccggtgaagacggaaagccgggcgacaccgggccacaaggcttcccc
gggactccaggggacgtaggtcccaagggcgacaagggagaccctggggttggagagaga
gggcccccaggaccccaagggcctccagggcccccaggaccctccttcagacacgacaag
ctgaccttcattgacatggagggatctggcttcgggggcgatctggaggccctgcggggt
cctcgaggcttccctggacctcccggaccccccggtgtcccaggcctgcccggcgagcca
ggccgctttggggtgaacagctccgacgtcccaggacccgccggccttcctggtgtgcct
gggcgcgagggtccccccgggtttcctggcctcccgggacccccaggccctccgggaaga
gaggggcccccaggaaggactgggcagaaaggcagcctgggtgaagcaggcgccccagga
cataaggggagcaagggagcccccggtcctgctggtgctcgtggggagagcggcctggca
ggagcccccggacctgctggaccaccaggcccccctgggccccctgggcccccaggacca
ggactccccgctggatttgatgacatggaaggctccggggggcccttctggtcaacagcc
cgaagcgctgatgggccacagggacctcccggcctgccgggacttaagggggatcctggc
gtgcctgggctgccgggggcgaagggagaagttggagcagatggagtccccgggttcccc
ggcctccctggcagagagggcattgctgggccccaggggccaaagggagacagaggcagc
cggggagaaaagggagatccagggaaggacggagtcgggcagccgggcctccctggcccc
cccggacccccgggacctgtggtctacgtgtcggagcaggacggatccgtcctgagcgtg
ccgggacctgagggccggccgggtttcgcaggctttcccggacctgcaggacccaagggc
aacctgggctctaagggcgaacgaggctccccgggacccaagggtgagaagggtgaaccg
ggcagcatcttcagccccgacggcggtgccctgggccctgcccagaaaggagccaaggga
gagccgggcttccgaggacccccgggtccatacggacggccggggtacaagggagagatt
ggctttcctggacggccgggtcgccccgggatgaacggattgaaaggagagaaaggggag
ccgggagatgccagccttggatttggcatgaggggaatgcccggccccccaggacctcca
gggcccccaggccctccagggactcctgtttacgacagcaatgtgtttgctgagtccagc
cgccccgggcctccaggattgccagggaatcagggccctccaggacccaagggcgccaaa
ggagaagtgggcccccccggaccaccagggcagtttccgtttgactttcttcagttggag
gctgaaatgaagggggagaagggagaccgaggtgatgcaggacagaaaggcgaaaggggg
gagcccgggggcggcggtttcttcggctccagcctgcccggcccccccggccccccaggc
ccacgtggctaccctgggattccaggtcccaagggagagagcatccggggccagcccggc
ccacctggacctcagggaccccccggcatcggctacgaggggcgccagggccctcccggc
cccccaggccccccagggcccccttcatttcctggccctcacaggcagactatcagcgtt
cccggccctccgggcccccctgggccccctgggccccctggaaccatgggcgcctcctca
ggggtgaggctctgggctacacgccaggccatgctgggccaggtgcacgaggttcccgag
ggctggctcatcttcgtggccgagcaggaggagctctacgtccgcgtgcagaacgggttc
cggaaggtccagctggaggcccggacaccactcccacgagggacggacaatgaagtggcc
gccttgcagccccccgtggtgcagctgcacgacagcaacccctacccgcggcgggagcac
ccccaccccaccgcgcggccctggcgggcagatgacatcctggccagcccccctcgcctg
cccgagccccagccctaccccggagccccgcaccacagctcctacgtgcacctgcggccg
gcgcgacccacaagcccacccgcccacagccaccgcgacttccagccggtgctccacctg
gttgcgctcaacagccccctgtcaggcggcatgcggggcatccgcggggccgacttccag
tgcttccagcaggcgcgggccgtggggctggcgggcaccttccgcgccttcctgtcctcg
cgcctgcaggacctgtacagcatcgtgcgccgtgccgaccgcgcagccgtgcccatcgtc
aacctcaaggacgagctgctgtttcccagctgggaggctctgttctcaggctctgagggt
ccgctgaagcccggggcacgcatcttctcctttgacggcaaggacgtcctgaggcacccc
acctggccccagaagagcgtgtggcatggctcggaccccaacgggcgcaggctgaccgag
agctactgtgagacgtggcggacggaggctccctcggccacgggccaggcctcctcgctg
ctggggggcaggctcctggggcagagtgccgcgagctgccatcacgcctacatcgtgctc
tgcattgagaacagcttcatgactgcctccaagtag

DBGET integrated database retrieval system