KEGG   Homo sapiens (human): 80781Help
Entry
80781             CDS       T01001                                 

Gene name
COL18A1, KNO, KNO1, KS
Definition
(RefSeq) collagen type XVIII alpha 1 chain
  KO
K06823  collagen, type XVIII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00271  Polymicrogyria
H00805  Vitreoretinal degeneration
H02074  Knobloch syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    80781 (COL18A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    80781 (COL18A1)
   00535 Proteoglycans [BR:hsa00535]
    80781 (COL18A1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    80781 (COL18A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   80781 (COL18A1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   80781 (COL18A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   80781 (COL18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endostatin Collagen DUF959 Fz Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 80781
NCBI-ProteinID: NP_569711
OMIM: 120328
HGNC: 2195
Ensembl: ENSG00000182871
Vega: OTTHUMG00000090407
Pharos: P39060(Tbio)
UniProt: P39060
Structure
PDB: 

Position
21q22.3
AA seq 1751 aa AA seqDB search
MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADT
TTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKG
IRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGA
HTTEAGTLPAPTPSPPSLGRPWAPLTGPSVPPPSSGRASLSSLLGGAPPWGSLQDPDSQG
LSPAAAAPSQQLQRPDVRLRTPLLHPLVMGSLGKHAAPSAFSSGLPGALSQVAVTTLTRD
SGAWVSHVANSVGPGLANNSALLGADPEAPAGRCLPLPPSLPVCGHLGISRFWLPNHLHH
ESGEQVRAGARAWGGLLQTHCHPFLAWFFCLLLVPPCGSVPPPAPPPCCQFCEALQDACW
SRLGGGRLPVACASLPTQEDGYCVLIGPAAERISEEVGLLQLLGDPPPQQVTQTDDPDVG
LAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKL
SGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQR
MPLARSSRGLELEPGAGLFVAQAGGADPDKFQGVIAELKVRRDPQVSPMHCLDEEGDDSD
GASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPLAGGSSTEDSRSEEVEEQTTV
ASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAGPPGSPCLPGP
PGLPCPVSPLGPAGPALQTVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTGPQGFP
GTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRG
PRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGR
EGPPGRTGQKGSLGEAGAPGHKGSKGAPGPAGARGESGLAGAPGPAGPPGPPGPPGPPGP
GLPAGFDDMEGSGGPFWSTARSADGPQGPPGLPGLKGDPGVPGLPGAKGEVGADGVPGFP
GLPGREGIAGPQGPKGDRGSRGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSV
PGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGALGPAQKGAKG
EPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPP
GPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLE
AEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGPPGPPGPRGYPGIPGPKGESIRGQPG
PPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGTMGASS
GVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVA
ALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRP
ARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSS
RLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHP
TWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVL
CIENSFMTASK
NT seq 5256 nt NT seq  +upstreamnt  +downstreamnt
atggctccctacccctgtggctgccacatcctgctgctgctcttctgctgcctggcggct
gcccgggccaacctgctgaacctgaactggctttggttcaataatgaggacaccagccat
gcagctaccacgatccctgagccccaggggcccctgcctgtgcagcccacagcagatacc
accacacacgtgaccccccggaatggttccacagagccagcgacagcccctggcagccct
gagccaccctcagagctgctggaagatggccaggacacccccacttctgccgagagcccg
gacgcgccagaggagaacattgccggtgtcggagccgagatcctgaacgtggccaaaggc
atccggagcttcgtccagctgtggaatgacactgtccccactgagagcttggccagggcg
gaaaccctggtcctggagactcctgtgggcccccttgccctcgctgggccttccagcacc
ccccaggagaatgggaccactctctggcccagccgtggcattcctagctctccgggcgcc
cacacaaccgaggctggcaccttgcctgcacccaccccatcgcctccctccctgggcagg
ccctgggcaccactcacggggccctcagtgccaccaccatcttcaggtagagcttctctc
tcctccttgctgggcggggcccctccctggggaagcctgcaggacccagacagccaagga
ctctcgcccgccgcagccgctcccagccagcagctccaacgccctgacgtccgcctgcgc
acgccacttctgcaccccctggtgatgggctccctgggcaagcacgcggccccctccgcc
ttctcctctgggctcccgggcgcactgtctcaggtcgcagtcaccactttaaccagggac
agcggtgcttgggtctcccacgtggctaactctgtggggccgggtcttgctaataactct
gccctgctcggggctgaccccgaggcccccgccggtcgctgcctgcccctgccaccctcc
ctgccagtctgcggccacctgggcatctcacgcttctggctgcccaaccacctccaccac
gagagcggcgagcaggtgcgggccggggcacgggcgtgggggggcctgctgcagacgcac
tgccaccccttcctcgcctggttcttctgcctgctgctggtccccccatgcggcagcgtc
ccgccgcccgccccgccaccctgctgccagttctgcgaggccctgcaggatgcgtgttgg
agccgcctgggcgggggccggctgcccgtcgcctgtgcctcgctcccgacccaggaggat
gggtactgtgtgctcattgggccggctgcagagcgcatcagcgaggaggtggggctgctg
cagctccttggggaccccccgccccagcaggtcacccagacggatgaccccgacgtcggg
ctggcctacgtctttgggccagatgccaacagtggccaagtggcccggtaccacttcccc
agcctcttcttccgtgacttctcactgctgttccacatccggccagccacagagggccca
ggggtgctgttcgccatcacggactcggcgcaggccatggtcttgctgggcgtgaagctc
tctggggtgcaggacgggcaccaggacatctccctgctctacacagaaccaggtgcaggc
cagacccacacagccgccagcttccggctccccgccttcgtcggccagtggacacactta
gccctcagtgtggcaggtggctttgtggccctctacgtggactgtgaggagttccagaga
atgccgcttgctcggtcctcacggggcctggagctggagcctggcgccgggctcttcgtg
gctcaggcggggggagcggaccctgacaagttccagggggtgatcgctgagctgaaggtg
cgcagggacccccaggtgagccccatgcactgcctggacgaggaaggcgatgactcagat
ggggcatccggagactctggcagcgggctcggggacgcccgggagcttctcagggaggag
acgggcgcggccctaaaacccaggctccccgcgccaccccccgtcaccacgccacccttg
gctggaggcagcagcacggaagattccagaagtgaagaagtcgaggagcagaccacggtg
gcttcgttaggagctcagacacttcctggctcagattctgtctccacgtgggacgggagt
gtccggacccctgggggccgcgtgaaagagggcggcctgaaggggcagaaaggggagcca
ggtgttccgggcccacctggccgggcaggccccccaggatccccatgcctacctggtccc
ccgggtctcccgtgcccagtgagtcccctgggtcctgcaggcccagcgttgcaaactgtc
cccggaccacaaggacccccagggcctccggggagggacggcacccctggaagggacggc
gagccgggcgaccccggtgaagacggaaagccgggcgacaccgggccacaaggcttcccc
gggactccaggggacgtaggtcccaagggcgacaagggagaccctggggttggagagaga
gggcccccaggaccccaagggcctccagggcccccaggaccctccttcagacacgacaag
ctgaccttcattgacatggagggatctggcttcgggggcgatctggaggccctgcggggt
cctcgaggcttccctggacctcccggaccccccggtgtcccaggcctgcccggcgagcca
ggccgctttggggtgaacagctccgacgtcccaggacccgccggccttcctggtgtgcct
gggcgcgagggtccccccgggtttcctggcctcccgggacccccaggccctccgggaaga
gaggggcccccaggaaggactgggcagaaaggcagcctgggtgaagcaggcgccccagga
cataaggggagcaagggagcccccggtcctgctggtgctcgtggggagagcggcctggca
ggagcccccggacctgctggaccaccaggcccccctgggccccctgggcccccaggacca
ggactccccgctggatttgatgacatggaaggctccggggggcccttctggtcaacagcc
cgaagcgctgatgggccacagggacctcccggcctgccgggacttaagggggatcctggc
gtgcctgggctgccgggggcgaagggagaagttggagcagatggagtccccgggttcccc
ggcctccctggcagagagggcattgctgggccccaggggccaaagggagacagaggcagc
cggggagaaaagggagatccagggaaggacggagtcgggcagccgggcctccctggcccc
cccggacccccgggacctgtggtctacgtgtcggagcaggacggatccgtcctgagcgtg
ccgggacctgagggccggccgggtttcgcaggctttcccggacctgcaggacccaagggc
aacctgggctctaagggcgaacgaggctccccgggacccaagggtgagaagggtgaaccg
ggcagcatcttcagccccgacggcggtgccctgggccctgcccagaaaggagccaaggga
gagccgggcttccgaggacccccgggtccatacggacggccggggtacaagggagagatt
ggctttcctggacggccgggtcgccccgggatgaacggattgaaaggagagaaaggggag
ccgggagatgccagccttggatttggcatgaggggaatgcccggccccccaggacctcca
gggcccccaggccctccagggactcctgtttacgacagcaatgtgtttgctgagtccagc
cgccccgggcctccaggattgccagggaatcagggccctccaggacccaagggcgccaaa
ggagaagtgggcccccccggaccaccagggcagtttccgtttgactttcttcagttggag
gctgaaatgaagggggagaagggagaccgaggtgatgcaggacagaaaggcgaaaggggg
gagcccgggggcggcggtttcttcggctccagcctgcccggcccccccggccccccaggc
ccacgtggctaccctgggattccaggtcccaagggagagagcatccggggccagcccggc
ccacctggacctcagggaccccccggcatcggctacgaggggcgccagggccctcccggc
cccccaggccccccagggcccccttcatttcctggccctcacaggcagactatcagcgtt
cccggccctccgggcccccctgggccccctgggccccctggaaccatgggcgcctcctca
ggggtgaggctctgggctacacgccaggccatgctgggccaggtgcacgaggttcccgag
ggctggctcatcttcgtggccgagcaggaggagctctacgtccgcgtgcagaacgggttc
cggaaggtccagctggaggcccggacaccactcccacgagggacggacaatgaagtggcc
gccttgcagccccccgtggtgcagctgcacgacagcaacccctacccgcggcgggagcac
ccccaccccaccgcgcggccctggcgggcagatgacatcctggccagcccccctcgcctg
cccgagccccagccctaccccggagccccgcaccacagctcctacgtgcacctgcggccg
gcgcgacccacaagcccacccgcccacagccaccgcgacttccagccggtgctccacctg
gttgcgctcaacagccccctgtcaggcggcatgcggggcatccgcggggccgacttccag
tgcttccagcaggcgcgggccgtggggctggcgggcaccttccgcgccttcctgtcctcg
cgcctgcaggacctgtacagcatcgtgcgccgtgccgaccgcgcagccgtgcccatcgtc
aacctcaaggacgagctgctgtttcccagctgggaggctctgttctcaggctctgagggt
ccgctgaagcccggggcacgcatcttctcctttgacggcaaggacgtcctgaggcacccc
acctggccccagaagagcgtgtggcatggctcggaccccaacgggcgcaggctgaccgag
agctactgtgagacgtggcggacggaggctccctcggccacgggccaggcctcctcgctg
ctggggggcaggctcctggggcagagtgccgcgagctgccatcacgcctacatcgtgctc
tgcattgagaacagcttcatgactgcctccaagtag

DBGET integrated database retrieval system