KEGG   Homo sapiens (human): 80790Help
Entry
80790             CDS       T01001                                 

Gene name
CMIP, TCMIP
Definition
(RefSeq) c-Maf inducing protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 PH Microtub_bd
Motif
Other DBs
NCBI-GeneID: 80790
NCBI-ProteinID: NP_938204
OMIM: 610112
HGNC: 24319
Ensembl: ENSG00000153815
Vega: OTTHUMG00000176520
Pharos: Q8IY22(Tbio)
UniProt: Q8IY22
Position
16q23.2-q23.3
AA seq 773 aa AA seqDB search
MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDI
QVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLL
SWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLK
EIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPP
DLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRLRLFTQEYILALNELNAG
MEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSPSLKEIRNGCQ
QPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPI
PFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDG
ELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNND
TQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSGS
FGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCE
TPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaccagcagctcgggcggcggcggcgacccccggcagatcgaggagaccaag
ccgctgctggggggcgacgtgtcggcccccgaaggcacgaagatgggcgccgtgccctgc
cgccgggctcttctgctttgcaacgggatgaggtacaaactgctgcaggagggcgacatt
caggtctgtgtcatccggcacccgcggacctttctcagcaagatcctcacctcgaaattc
ctgaggcgctgggagccgcaccacctaacgctggccgacaacagcctggcgtccgccacg
ccaactgggtacatggaaaactcagtctcctacagcgcaattgaagacgttcagctgctg
tcctgggagaatgccccgaagtactgtttacagctcacgattcctgggggaactgtctta
ctgcaggctgccaatagctacctgcgagaccagtggttccattctctgcaatggaagaaa
aagatttacaaatataagaaagtgctgagtaacccaagccgctgggaagttgtcttgaaa
gagatccggaccctggtggacatggccctgacatcccccctgcaggatgactccatcaac
caggccccactggaaatcgtctcgaaactgctctcagagaacacaaacttgaccacccag
gagcatgaaaacatcattgtggcaatcgctcctttgctggaaaacaaccacccaccacca
gatctctgtgaattcttttgcaagcactgcagagagcggccccggtccatggtggtcatc
gaggtgttcacccccgtggtgcagcgaatcctcaagcataacatggactttgggaagtgc
ccgcgactgaggctgtttactcaggagtacatccttgccttgaacgagctcaacgcgggg
atggaagtggtgaagaagttcattcagagcatgcacggccccacagggcactgcccccac
ccccgggtcctgcccaacctggtggccgtgtgcctggctgccatctactcctgctatgaa
gagttcatcaacagccgcgacaattccccaagcctgaaggaaatccggaacggctgccag
cagccgtgcgaccggaagcccactttacctctgcgccttctgcaccccagcccggacctg
gtgtctcaggaagccacgctgtctgaggcccggctcaagtcggtggtcgtggcctccagt
gagatccacgtggaggtggaacgcaccagcactgccaagccggcgctgacggccagcgca
ggcaacgacagcgagcccaacctcatcgactgcctcatggtcagccccgcctgcagcacc
atgagcatcgagctgggcccccaggccgaccgcacgctcggctgctacgtggaaatcctc
aagctgctgtcagactatgatgactggagaccgtctctggccagtttgcttcaacccatt
ccattccccaaagaagctctcgcacatgagaagttcaccaaggaactgaagtacgtgatt
cagaggttcgccgaagaccccaggcaagaggtccactcatgcctgctgagcgtgcgggcc
ggcaaagatggctggttccagctctacagccccggaggggtggcctgcgacgatgacggg
gagctgttcgccagcatggtgcacatcctcatgggctcctgttacaagaccaaaaaattc
ctgctctccctggcagaaaacaagctgggtccctgcatgctcctggcactgagggggaac
cagaccatggtggagatcctgtgcttgatgctggaatacaacatcatcgacaacaacgac
acccaactgcagatcatctcaaccctggagagcacagacgtggggaagcgcatgtacgag
cagctgtgtgaccggcagcgggagctgaaggagctgcaaaggaaaggcgggcccaccagg
ctaacactgccctccaagtccacagacgctgacttggctcgtttgctgagctccggctcc
ttcggaaacctggagaacctcagtttggccttcaccaatgtaaccagtgcctgcgccgag
cacctcatcaaactgccttcgctcaagcagctgaacctgtggtccactcagtttggagac
gctggccttcggctcctgtcggaacacctcaccatgctccaggtgctgaacctgtgcgag
accccggtcacagacgctggcctgctggccctgagctccatgaagagtctctgcagttta
aacatgaacagcaccaagctctcagctgacacctacgaagatctgaaggccaagcttccc
aatttgaaggaagtggacgtccgctacaccgaagcctggtga

DBGET integrated database retrieval system