KEGG   Homo sapiens (human): 80817
Entry
80817             CDS       T01001                                 
Symbol
CEP44, KIAA1712, PS1TP3
Name
(RefSeq) centrosomal protein 44
  KO
K16761  centrosomal protein CEP44
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80817 (CEP44)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    80817 (CEP44)
SSDB
Motif
Pfam: CEP44 NPV_P10 FlgN
Other DBs
NCBI-GeneID: 80817
NCBI-ProteinID: NP_001035247
HGNC: 29356
Ensembl: ENSG00000164118
Pharos: Q9C0F1(Tdark)
UniProt: Q9C0F1
Position
4:174283706..174333381
AA seq 390 aa
MATGDLKRSLRNLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIME
SNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKH
KELSSLQKIPSQQRKKISSGKSEPPLGNEKISAEAVGVDISGRFMTSGKKKAVVIRHLYN
EDNVDISEDTLSPITDVNEAVDVSDLNATEIKMPEVKVPEIKAEQQDVNVNPEITALQTM
LAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSKKNDEFI
EFNEVSEDYASCSDMDLLNPHRKSEVERPASIPLSSGYSTASSDSTPRASTVNYCGLNEI
SEETTIQKMERMKKMFEETAELLKCPNHYL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcaacaggtgacttaaaaagaagcttacggaacctagaacaggtgctccgcttgcta
aattatcctgaagaggtggactgtgtaggtttgataaagggagacccagcagcatctttg
cccatcatcagctattcttttacctcatactcaccttatgtaacagaacttataatggaa
tccaatgtagagctcatagcaaaaaatgacttgcgctttatagatgctgtctataagctt
cttcgtgatcaatttaattataaaccaattttgacaaaaaagcagtttatccaatgtggg
tttgcagaatggaaaatccaaattgtttgtgatattttgaattgtgtgatgaaaaagcac
aaggaattaagcagtcttcagaagattccatcacaacaaagaaagaaaatcagttctggt
aagtcagaacctcctttgggcaatgagaaaatatctgcagaggctgttggcgttgatatc
agtggcaggtttatgacctcaggaaagaagaaagctgtggtgattcgtcacttgtataat
gaagataatgttgacatttctgaggatacattaagtccaataacagatgttaatgaagca
gttgatgtgtctgacttaaatgctactgaaataaagatgcctgaagtaaaggttcctgaa
atcaaggctgagcaacaggatgtaaatgttaatcctgagattactgcactacaaactatg
cttgctgaatgccaagaaaatcttaagaaactgacttcgatagagaaaaggttagactgt
ttggaacaaaaaatgaaaggaaaagtgatggtagatgaaaacacctggactaatcttctt
agtcgtgtcactcttcttgaaacagaaatgcttttgtctaaaaagaatgatgaatttata
gagtttaatgaagttagtgaagactacgcttcttgtagtgacatggaccttctgaatcct
cacagaaaaagcgaagtagagaggccagcaagtattcctctgtcctctggctatagtaca
gcatcatcagattcaactcccagagcctctactgttaattactgtggtttgaatgagatt
tcagaggaaacaacaatccagaaaatggaaaggatgaaaaaaatgtttgaagaaactgca
gagttactgaaatgtccaaatcactacttgtag

DBGET integrated database retrieval system