KEGG   Homo sapiens (human): 80830Help
Entry
80830             CDS       T01001                                 

Gene name
APOL6, APOL-VI, APOLVI
Definition
(RefSeq) apolipoprotein L6
  KO
K14480  apolipoprotein L
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    80830 (APOL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL Glyco_hydro_44 IMD
Motif
Other DBs
NCBI-GeneID: 80830
NCBI-ProteinID: NP_085144
OMIM: 607256
HGNC: 14870
Ensembl: ENSG00000221963
Vega: OTTHUMG00000150615
Pharos: Q9BWW8(Tbio)
UniProt: Q9BWW8 B3KTP4
Position
22q12.3
AA seq 343 aa AA seqDB search
MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKL
RALADDIDKTHKKFTKANMVATSTAVISGVMSLLGLALAPATGGGSLLLSTAGQGLATAA
GVTSIVSGTLERSKNKEAQARAEDILPTYDQEDREDEEEKADYVTAAGKIIYNLRNTLKY
AKKNVRAFWKLRANPRLANATKRLLTTGQVSSRSRVQVQKAFAGTTLAMTKNARVLGGVM
SAFSLGYDLATLSKEWKHLKEGARTKFAEELRAKALELERKLTELTQLYKSLQQKVRSRA
RGVGKDLTGTCETEAYWKELREHVWMWLWLCVCLCVCVYVQFT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaggcggagagagaaagtgaggctggtgttggtttgcaaagggatgaggat
gacgctcctctgtgtgaagacgtggagctacaagacggagatctgtcccccgaagaaaaa
atatttttgagagaatttcccagattgaaagaagatctgaaagggaacattgacaagctc
cgtgccctcgcagacgatattgacaaaacccacaagaaattcaccaaggctaacatggtg
gccacctctactgctgtcatctctggagtgatgagcctcctgggtttagcccttgcccca
gcaacaggaggaggaagcctgctgctctccaccgctggtcaaggtttggcaacagcagct
ggggtcaccagcatcgtgagtggtacgttggaacgctccaaaaataaagaagcccaagca
cgggcggaagacatactgcccacctacgaccaagaggacagggaggatgaggaagagaag
gcagactatgtcacagctgctggaaagattatctataatcttagaaacaccttgaagtat
gccaagaaaaacgtccgtgcattttggaaactcagagccaacccacgcttggccaatgct
accaagcgtcttctgaccactggccaagtctcctcccggagccgcgtgcaggtgcaaaag
gcctttgcgggaacaacactggcgatgaccaaaaatgctcgcgtgctgggaggtgtgatg
tccgccttctcccttggctatgacttggccactctctcaaaggaatggaagcacctgaag
gaaggagcaaggacaaagtttgcggaagagttgagagccaaggccttggagctggagagg
aaactcacagaactcacccagctctacaagagcttgcagcagaaagtgaggtcaagggcc
agaggggtggggaaggatttaactgggacctgcgaaaccgaggcttactggaaggagtta
agggagcatgtgtggatgtggctgtggctgtgtgtgtgtctgtgtgtctgtgtgtatgta
cagtttacatga

DBGET integrated database retrieval system