KEGG   Homo sapiens (human): 80833Help
Entry
80833             CDS       T01001                                 

Gene name
APOL3, APOLIII, CG121, CG12_1, apoL-III
Definition
(RefSeq) apolipoprotein L3
  KO
K14480  apolipoprotein L
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    80833 (APOL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL DUF3150 TBCA Transposase_mut
Motif
Other DBs
NCBI-GeneID: 80833
NCBI-ProteinID: NP_663615
OMIM: 607253
HGNC: 14868
Ensembl: ENSG00000128284
Vega: OTTHUMG00000150632
Pharos: O95236(Tbio)
UniProt: O95236
Position
22q12.3
AA seq 402 aa AA seqDB search
MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLR
TAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEA
DALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEV
HRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIV
EHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQ
ARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYES
KHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggactgggccaagggtggggctgggaagcatcctgttttgcatgtttgatcaggagc
tgctgccaagttgtgactttcactttcccttttgggttccagggtatatctcagagcctg
gagaacgtgtctggttattatgcagatgcacggctggaggtgggatccacacagctcaga
acagctggatcttgctcacactctttcaagagaagcttccttgaaaagaaacgctttact
gaagaggccaccaaatacttccgggagagagtcagcccagtgcatctgcaaatcctgctg
actaacaatgaagcctggaagagattcgtgactgcggctgaattgcccagggatgaggca
gatgctctctacgaagctctgaagaagcttagaacatatgcagctattgaggacgaatat
gtgcagcagaaagatgagcagtttagggaatggtttttgaaagagtttccccaagtcaag
aggaagatccaggagtccatagaaaagcttcgtgcccttgcaaatggtattgaagaggtc
cacagaggctgcaccatctccaatgtggtgtccagctccactggcgctgcctctggcatc
atgtcccttgctggtcttgttttggcaccatttacagcagggacgagtctggcccttact
gcagctggggtagggctgggagcagcgtctgctgtgactgggatcaccaccagcatcgtg
gagcactcatacacatcatcagcagaagctgaagccagcaggctgactgcaaccagcatt
gaccgattgaaggtatttaaggaagttatgcgtgacatcacacccaacttactttccctt
cttaataattattacgaagccacacaaaccattgggagtgaaatccgtgccatcaggcaa
gccagagccagggcccgactccctgtgaccacctggcgaatctcagctggaagtggtggt
caagcagagagaacgattgcaggcaccacccgggcagtgagcagaggagcccggatcctg
agtgcgaccacttcaggcatcttccttgcactggatgtggtcaaccttgtatacgagtca
aagcacttgcatgagggggcaaagtctgcatctgctgaggagctgaggcggcaggctcag
gagctggaggagaatctaatggagctcactcagatctatcagcgtctgaatccatgccat
acccactga

DBGET integrated database retrieval system