KEGG   Homo sapiens (human): 80834Help
Entry
80834             CDS       T01001                                 

Gene name
TAS1R2, GPR71, T1R2, TR2
Definition
(RefSeq) taste 1 receptor member 2
  KO
K04625  taste receptor type 1 member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
hsa04973  Carbohydrate digestion and absorption
Drug target
Acesulfame potassium: D08836
Aspartame (DG01355): D02381 D08862
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    80834 (TAS1R2)
  09157 Sensory system
   04742 Taste transduction
    80834 (TAS1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    80834 (TAS1R2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    80834 (TAS1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G DUF3408
Motif
Other DBs
NCBI-GeneID: 80834
NCBI-ProteinID: NP_689418
OMIM: 606226
HGNC: 14905
Ensembl: ENSG00000179002
Vega: OTTHUMG00000002442
Pharos: Q8TE23(Tbio)
UniProt: Q8TE23
Position
1p36.13
AA seq 839 aa AA seqDB search
MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCK
EYEVKVIGYNLMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDN
LLPIQEDYSNYISRVVAVIGPDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPAL
LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL
PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIA
SESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCN
QECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQD
ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPN
NEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAG
GPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFK
MASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSC
NPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFM
SAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggggcccagggcaaagaccatctcctccctgttcttcctcctatgggtcctggctgag
ccggctgagaactcggacttctacctgcctggggattacctcctgggtggcctcttctcc
ctccatgccaacatgaagggcattgttcaccttaacttcctgcaggtgcccatgtgcaag
gagtatgaagtgaaggtgataggctacaacctcatgcaggccatgcgctttgcggtggag
gagatcaacaatgacagcagcctgctgcctggtgtgctgctgggctatgagatcgtggat
gtgtgctacatctccaacaatgtccagccggtgctctacttcctggcacacgaggacaac
ctccttcccatccaagaggactacagtaactacatttcccgtgtggtggctgtcattggc
cctgacaactccgagtctgtcatgactgtggccaacttcctctccctatttctccttcca
cagatcacctacagcgccatcagcgatgagctgcgagacaaggtgcgcttcccggctttg
ctgcgtaccacacccagcgccgaccaccacatcgaggccatggtgcagctgatgctgcac
ttccgctggaactggatcattgtgctggtgagcagcgacacctatggccgcgacaatggc
cagctgcttggcgagcgcgtggcccggcgcgacatctgcatcgccttccaggagacgctg
cccacactgcagcccaaccagaacatgacgtcagaggagcgccagcgcctggtgaccatt
gtggacaagctgcagcagagcacagcgcgcgtcgtggtcgtgttctcgcccgacctgacc
ctgtaccacttcttcaatgaggtgctgcgccagaacttcactggcgccgtgtggatcgcc
tccgagtcctgggccatcgacccggtcctgcacaacctcacggagctgcgccacttgggc
accttcctgggcatcaccatccagagcgtgcccatcccgggcttcagtgagttccgcgag
tggggcccacaggctgggccgccacccctcagcaggaccagccagagctatacctgcaac
caggagtgcgacaactgcctgaacgccaccttgtccttcaacaccattctcaggctctct
ggggagcgtgtcgtctacagcgtgtactctgcggtctatgctgtggcccatgccctgcac
agcctcctcggctgtgacaaaagcacctgcaccaagagggtggtctacccctggcagctg
cttgaggagatctggaaggtcaacttcactctcctggaccaccaaatcttcttcgacccg
caaggggacgtggctctgcacttggagattgtccagtggcaatgggaccggagccagaat
cccttccagagcgtcgcctcctactaccccctgcagcgacagctgaagaacatccaagac
atctcctggcacaccatcaacaacacgatccctatgtccatgtgttccaagaggtgccag
tcagggcaaaagaagaagcctgtgggcatccacgtctgctgcttcgagtgcatcgactgc
cttcccggcaccttcctcaaccacactgaagatgaatatgaatgccaggcctgcccgaat
aacgagtggtcctaccagagtgagacctcctgcttcaagcggcagctggtcttcctggaa
tggcatgaggcacccaccatcgctgtggccctgctggccgccctgggcttcctcagcacc
ctggccatcctggtgatattctggaggcacttccagacacccatagttcgctcggctggg
ggccccatgtgcttcctgatgctgacactgctgctggtggcatacatggtggtcccggtg
tacgtggggccgcccaaggtctccacctgcctctgccgccaggccctctttcccctctgc
ttcacaatctgcatctcctgtatcgccgtgcgttctttccagatcgtctgcgccttcaag
atggccagccgcttcccacgcgcctacagctactgggtccgctaccaggggccctacgtc
tctatggcatttatcacggtactcaaaatggtcattgtggtaattggcatgctggccacg
ggcctcagtcccaccacccgtactgaccccgatgaccccaagatcacaattgtctcctgt
aaccccaactaccgcaacagcctgctgttcaacaccagcctggacctgctgctctcagtg
gtgggtttcagcttcgcctacatgggcaaagagctgcccaccaactacaacgaggccaag
ttcatcaccctcagcatgaccttctatttcacctcatccgtctccctctgcaccttcatg
tctgcctacagcggggtgctggtcaccatcgtggacctcttggtcactgtgctcaacctc
ctggccatcagcctgggctacttcggccccaagtgctacatgatcctcttctacccggag
cgcaacacgcccgcctacttcaacagcatgatccagggctacaccatgaggagggactag

DBGET integrated database retrieval system