KEGG   Homo sapiens (human): 80852Help
Entry
80852             CDS       T01001                                 

Gene name
GRIP2
Definition
(RefSeq) glutamate receptor interacting protein 2
  KO
K20251  glutamate receptor-interacting protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80852 (GRIP2)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   Glutamate receptor-interacting proteins (GRIPs)
    80852 (GRIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 80852
NCBI-ProteinID: NP_001073892
HGNC: 23841
Ensembl: ENSG00000144596
Vega: OTTHUMG00000155544
Pharos: Q9C0E4(Tdark)
UniProt: Q9C0E4
Structure
PDB: 

Position
3p25.1
AA seq 1043 aa AA seqDB search
MLCGLSRETPGEADDGPYSKGGKDAGGADVSLACRRQSIPEEFRGITVVELIKKEGSTLG
LTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVG
ERVVLEVEYELPPPAPENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTY
VRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTV
ANASGPLMVEIVKTPGSALGISLTTTSLRNKSVITIDRIKPASVVDRSGALHPGDHILSI
DGTSMEHCSLLEATKLLASISEKVRLEILPVPQSQRPLRPSEAVKVQRSEQLHRWDPCVP
SCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRT
TMGRRRQRRREHKSSLSLASSTVGPGGQIVHTETTEVVLCGDPLSGFGLQLQGGIFATET
LSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLE
VEFDVAESVIPSSGTFHVKLPKKRSVELGITISSASRKRGEPLIISDIKKGSVAHRTGTL
EPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELK
RYGGPLGITISGTEEPFDPIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAI
HLLQVAGETVTLKIKKQLDRPLLPRKSGSLSETSDADEDPADALKGGLPAARFSPAVPSV
DSAVESWDSSATEGGFGGPGSYTPQAAARGTTPQERRPGWLRGSPPPTEPRRTSYTPTPA
DESFPEEEEEDDWEPPTSPAPGPAREEGFWRMFGEALEDLESCGQSELLRELEASIMTGT
VQRVALEGRPGHRPWQRGREVRASPAEMEELLLPTPLEMHKVTLHKDPMRHDFGFSVSDG
LLEKGVYVHTVRPDGPAHRGGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELIIS
RKPHTAHSSRAPRSPGPSSPRML
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtgggctcagccgggagacccctggagaggcggacgatgggccctactccaaa
ggaggcaaggacgcaggaggggccgacgtttccctggcgtgccgcagacagagcattcca
gaggagttccgagggatcactgtggtggagctgatcaagaaagaaggcagcacgctgggc
ctgactatctcaggtggcaccgacaaggatggaaagcccagggtctccaacctgagacct
gggggacttgcagccaggagtgatctgctgaacattggtgactatattcggtctgtgaac
gggatccacctgaccaggctccgccacgatgagatcatcaccctgctcaagaatgtgggc
gagcgcgtggtgctggaggtggagtatgagctgcccccgcccgctcctgagaataacccc
aggatcatttcaaagacagtggacgtctccctctacaaggagggcaatagctttggcttt
gtccttagaggaggtgcccatgaagatgggcacaagtcccgcccgcttgtcctgacctac
gtgcggcccggtggccctgccgacagggagggctccctgaaggtgggcgacaggctgctc
agtgtcgatggaatcccgctgcacggggccagccatgccaccgccctggccaccctgcgg
cagtgcagccacgaggcactctttcaggtggagtatgatgtggccacccctgacacggtg
gctaatgcttcgggacccttgatggtggaaatagtcaagacgccagggtctgccctgggg
atctcgctcaccaccacctccctccggaacaagtcagtcattaccatcgaccgcatcaag
ccagccagcgtggtggacaggagcggagccctgcaccctggagaccacatcctgtccatc
gatggcaccagcatggaacactgctcgctgcttgaggccaccaagctcctggccagcatt
tcagagaaggtgcggctggagatcctgcctgtgccccagagtcagcggccactgaggccc
tcagaggcagtgaaagtgcagaggagtgagcagctgcaccgctgggacccctgcgtgccc
tcctgccacagcccccggcccggccactgcaggatgcccacctgggccacacctgctggc
caggaccaaagccgatccttgtcttcaactcccttttcctcgccgaccttgaaccacgcc
ttttcctgcaacaaccccagcacccttccccgtggatcccagcccatgagtcctcgaact
acaatggggcggaggaggcagcgaagaagggaacacaagagctcgttgtcgctagcctcc
agcacggtggggccgggcgggcagattgtgcacacggagaccacggaggtcgtgctctgt
ggagaccccctcagcggctttggcctccagctccagggcggcatcttcgccaccgagacc
ctgtcctccccacccctcgtgtgcttcatcgagcctgacagtccggctgagaggtgtggg
ctgctgcaggtgggggaccgtgtcctgtccatcaatggcattgccaccgaggacgggact
atggaggaagccaaccagctcctgcgggacgccgcactggcccacaaggtcgtgctggag
gtggagttcgatgtggcggagtccgtcatcccaagcagtggcaccttccacgtgaagctg
cccaagaagcgcagcgtggagctgggcatcaccatcagctcggccagcaggaaacgaggg
gagcccttgatcatctccgacatcaagaaaggcagcgtggcacacaggacgggcaccctg
gagccaggcgacaagctactggccattgacaatatccgcctggacaactgccccatggag
gacgccgtgcaaatcctgcggcagtgcgaggacctggtgaagctgaagatccggaaggac
gaggacaactctgatgagctggagaccacaggtgccgtcagttacacagtggagctgaag
cgctacgggggtcccctgggcatcaccatttcgggcacggaggaaccttttgaccccatt
gtcatctcaggcctcaccaagcgtggcctggctgagaggactggtgccatccacgtgggg
gaccgcattctggccatcaacaacgttagcctcaagggccggccgctgagcgaggccatc
cacctcctgcaggtggctggagagaccgtcacactgaagatcaagaagcaactagaccgt
cccctcctaccccgcaagtcgggcagcctcagtgagaccagtgatgctgatgaggaccca
gcagatgccctgaaaggaggcctgccagcagcccgcttctcgccggctgtgcccagtgtg
gacagtgctgtggagtcttgggacagctcggccaccgagggtggctttgggggcccaggg
tcctatacaccacaggcagcagcccggggcacgaccccccaggagcggaggcctggctgg
ctgaggggcagccccccacccaccgagccccggaggacgagctataccccaaccccagct
gacgagagctttccagaggaggaggaggaggatgattgggagccgccaacgagcccagcc
cctggccctgcccgagaggagggcttctggcgcatgtttggagaagctctcgaagacctg
gagtcatgtggtcagtcagagctgctgagggaactggaggcatccatcatgacgggcacc
gtgcagagggtggccctcgagggcaggcctggccaccggccttggcagaggggccgggag
gtacgagcctctcctgcagaaatggaggagctgttgctgcctacacccttggagatgcac
aaggtgaccctgcacaaggaccccatgcggcatgactttggtttcagcgtctcagatggc
ctcctggaaaaaggtgtctatgtccacactgtgcgccctgatgggccagcccaccgtgga
ggcctccagcccttcgacagggtcctgcaggtcaaccacgtccgtacacgggacttcgac
tgctgcctggcggtgccactcctggccgaggcgggtgatgtcttggagctgatcatcagc
cgcaagccgcacacggcacacagcagccgggccccccgatcgccaggccccagcagtccc
cggatgctctga

DBGET integrated database retrieval system