KEGG   Homo sapiens (human): 8089
Entry
8089              CDS       T01001                                 

Gene name
YEATS4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9
Definition
(RefSeq) YEATS domain containing 4
  KO
K11341  YEATS domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8089 (YEATS4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     8089 (YEATS4)
    NuA4 complex
     8089 (YEATS4)
  Chromatin remodeling factors
   SRCAP complex
    8089 (YEATS4)
   SWR1 complex
    8089 (YEATS4)
SSDB
Motif
Pfam: YEATS SOGA RIC3
Other DBs
NCBI-GeneID: 8089
NCBI-ProteinID: NP_006521
OMIM: 602116
HGNC: 24859
Ensembl: ENSG00000127337
Vega: OTTHUMG00000169358
Pharos: O95619(Tbio)
UniProt: O95619
Structure
PDB: 
5VNA 5XTZ 5VNB 5Y8V

Position
12q15
AA seq 227 aa
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
NT seq 684 nt   +upstreamnt  +downstreamnt
atgttcaagagaatggccgaatttgggcctgactccggcgggagagtaaagggtgttact
atcgttaaaccaatagtttacggtaatgttgctcggtattttggaaagaaaagagaagaa
gatgggcacactcatcagtggacagtatatgtgaaaccatatagaaatgaggatatgtca
gcatatgtgaagaaaatccagtttaaattacatgaaagctatggcaatcctttaagagtt
gttactaaacctccatatgaaattactgaaacaggatggggtgaattcgaaataatcatc
aaaatatttttcattgaccctaatgaaagacctgtaaccctgtatcatttgctaaagctg
tttcaatcagacaccaatgcaatgctggggaaaaagacagtggtttcagagttctatgat
gaaatgatatttcaagacccaacagcaatgatgcaacaattattgacaacatctcgtcag
ctaacattaggagcctataagcatgaaacagaatttgcagagcttgaagtgaaaaccaga
gaaaaattagaagctgctaagaaaaaaacaagctttgagattgcagagcttaaggagaga
ttaaaagcaagtcgtgaaactataaattgtttaaaaaatgaaatcagaaaacttgaagaa
gatgaccaagcaaaagacatataa

DBGET integrated database retrieval system