KEGG   Homo sapiens (human): 80896
Entry
80896             CDS       T01001                                 
Symbol
NPL, C112, C1orf13, NAL, NPL1
Name
(RefSeq) N-acetylneuraminate pyruvate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    80896 (NPL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     80896 (NPL)
SSDB
Motif
Pfam: DHDPS Peptidase_M42
Other DBs
NCBI-GeneID: 80896
NCBI-ProteinID: NP_110396
OMIM: 611412
HGNC: 16781
Ensembl: ENSG00000135838
UniProt: Q9BXD5
Position
1:182789773..182830384
AA seq 320 aa
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSV
SERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWT
KDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLL
DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFS
LALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKL
KSLDFLSFTDLKDGNLEAGS
NT seq 963 nt   +upstreamnt  +downstreamnt
atggccttcccaaagaagaaacttcagggtcttgtggctgcaaccatcacgccaatgact
gagaatggagaaatcaacttttcagtaattggtcagtatgtggattatcttgtgaaagaa
cagggagtgaagaacatttttgtgaatggcacaacaggagaaggcctgtccctgagcgtc
tcagagcgtcgccaggttgcagaggagtgggtgacaaaagggaaggacaagctggatcag
gtgataattcacgtaggagcactgagcttgaaggagtcacaggaactggcccaacatgca
gcagaaataggagctgatggcatcgctgtcattgcaccgttcttcctcaagccatggacc
aaagatatcctgattaatttcctaaaggaagtggctgctgccgcccctgccctgccattt
tattactatcacattcctgccttgacaggggtaaagattcgtgctgaggagttgttggat
gggattctggataagatccccaccttccaagggctgaaattcagtgatacagatctctta
gacttcgggcaatgtgttgatcagaatcgccagcaacagtttgctttcctttttggggtg
gatgagcaactgttgagtgctctggtgatgggagcaactggagcagtgggcagtacctat
aactacctgggaaaaaagacaaaccagatgttggaggcttttgaacaaaaggacttctct
ttagccctgaactatcagttttgtatccagagatttatcaactttgttgtcaaactaggt
tttggagtgtcacagaccaaagccatcatgactctggtctctgggattccaatgggccca
ccccggcttccactgcagaaagcctccagggagtttactgatagtgctgaagctaaactg
aagagcctggatttcctttctttcactgatttaaaggatggaaacttggaagctggtagc
tag

DBGET integrated database retrieval system