KEGG   Homo sapiens (human): 8099Help
Entry
8099              CDS       T01001                                 

Gene name
CDK2AP1, DOC1, DORC1, ST19, doc-1, p12DOC-1
Definition
(RefSeq) cyclin dependent kinase 2 associated protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CDK2AP DUF4248
Motif
Other DBs
NCBI-GeneID: 8099
NCBI-ProteinID: NP_004633
OMIM: 602198
HGNC: 14002
Ensembl: ENSG00000111328
Vega: OTTHUMG00000168854
Pharos: O14519(Tbio)
UniProt: O14519
Structure
PDB: 

Position
12q24.31
AA seq 115 aa AA seqDB search
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ
SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaaaccgaacttggccgcgcacatgcccgccgccgccctcaacgccgctggg
agtgtccactcgccttccaccagcatggcaacgtcttcacagtaccgccagctgctcagt
gactacgggccaccgtccctaggctacacccagggaactgggaacagccaggtgccccaa
agcaaatacgcggagctgctggccatcattgaagagctggggaaggagatcagacccacg
tacgcagggagcaagagtgccatggagaggctgaagcgcggcatcattcacgctagagga
ctggttcgggagtgcttggcagaaacggaacggaatgccagatcctag

DBGET integrated database retrieval system