KEGG   Homo sapiens (human): 8100
Entry
8100              CDS       T01001                                 
Symbol
IFT88, D13S1056E, DAF19, TG737, TTC10, hTg737
Name
(RefSeq) intraflagellar transport 88
  KO
K16474  intraflagellar transport protein 88
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    8100 (IFT88)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B1
   8100 (IFT88)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_12 TPR_7 TPR_8 TPR_19 TPR_6 TPR_16 TPR_14 TPR_11 ANAPC3 TPR_10 TPR-S TPR_9 TPR_17 TPR_21 Iml2-TPR_39 TPR_15 RPN7 DUF6584 Coatomer_E DUF2225 FumaraseC_C
Other DBs
NCBI-GeneID: 8100
NCBI-ProteinID: NP_006522
OMIM: 600595
HGNC: 20606
Ensembl: ENSG00000032742
Pharos: Q13099(Tbio)
UniProt: Q13099 A0A140VJL7 B3KX42
Position
13:20567157..20691444
AA seq 824 aa
MMQNVHLAPETDEDDLYSGYNDYNPIYDIEELENDAAFQQAVRTSHGRRPPITAKISSTA
VTRPIATGYGSKTSLASSIGRPMTGAIQDGVTRPMTAVRAAGFTKAALRGSAFDPLSQSR
GPASPLEAKKKDSPEEKIKQLEKEVNELVEESCIANSCGDLKLALEKAKDAGRKERVLVR
QREQVTTPENINLDLTYSVLFNLASQYSVNEMYAEALNTYQVIVKNKMFSNAGILKMNMG
NIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMS
MAPNLKAGYNLTICYFAIGDREKMKKAFQKLITVPLEIDEDKYISPSDDPHTNLVTEAIK
NDHLRQMERERKAMAEKYIMTSAKLIAPVIETSFAAGYDWCVEVVKASQYVELANDLEIN
KAVTYLRQKDYNQAVEILKVLEKKDSRVKSAAATNLSALYYMGKDFAQASSYADIAVNSD
RYNPAALTNKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDC
FLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREG
DKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMV
ASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMK
EIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSS
NKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgatgcaaaatgtgcacctggctccagagacagatgaagatgatctttattccggctat
aatgactacaatccaatctatgatatcgaggaattggagaatgatgcagcttttcagcaa
gctgtgaggactagtcatggcagaagacctccaataactgctaaaatatcaagcacggca
gttactagacctatagctactggatatgggtccaagacatctctggcatcatcaatagga
agaccaatgacaggggctattcaggatggagttactagacccatgacagcagtgagagca
gctggttttaccaaagcagctttgagaggctctgcatttgacccccttagtcagtcaagg
ggccctgcttcccctttggaagccaagaaaaaagatagcccagaggaaaaaataaagcaa
ttagagaaggaagtaaatgagttggtagaagaaagctgtattgccaatagttgtggagac
ttaaaattggccttagaaaaggcaaaagatgcaggaagaaaagagagagtcctggtgaga
cagcgagaacaagttacaactccagaaaatatcaatttggatttaacttactcagttctt
ttcaatttggccagtcagtattcagttaatgaaatgtatgccgaagcacttaacacttat
caagttatagtcaaaaataagatgtttagcaatgcaggaatattgaaaatgaatatggga
aatatctatttaaagcaaagaaattattccaaagccattaaattctaccgaatggcatta
gaccaagttccaagtgtcaataagcaaatgaggattaaaataatgcagaatattggagtt
acatttattcaggctggtcagtattcagatgctattaattcatatgagcacataatgagc
atggcaccaaatctgaaggcaggctacaacctaactatctgttattttgctattggagac
cgagaaaaaatgaagaaggcattccaaaaattgattactgttccattagaaattgatgaa
gataaatatatttcaccaagtgatgatcctcatactaacttagtaactgaagctataaaa
aatgatcacctcaggcaaatggaacgtgaaaggaaagccatggcagaaaaatatattatg
acatctgcaaaactcattgctcctgtaattgaaacatcttttgctgcaggttatgattgg
tgcgtggaagtggtgaaagcttctcaatatgtagagctagccaatgatctggaaataaac
aaagcagttacatacttgagacaaaaagactataaccaagctgtagagatcttaaaagtg
ttggaaaaaaaggacagtagagtgaaaagtgcagctgcaaccaatctctcagccctgtat
tatatgggaaaggattttgcacaagccagcagctatgcagatatagctgtgaactctgat
agatataatccagcagctcttactaataaagggaatacagtttttgcaaatggtgattat
gagaaggccgctgaattctataaagaggctctaagaaatgattcttcttgtactgaagca
ctttataatattggccttacctatgagaaactaaatcggctagatgaggctttggactgt
ttcctgaaacttcacgcaatcctacgaaacagtgccgaagttctttaccagatagcaaat
atatatgaattaatggaaaatcccagtcaagctattgaatggctaatgcaggtggtcagt
gttattccaaccgatcctcaagttttatctaagctaggagaattatatgatcgtgaagga
gataaatctcaagcatttcaatattactatgagtcatataggtattttccttgtaatatt
gaagtcattgagtggcttggagcctattacattgacacccaattttgggaaaaagctatt
cagtactttgaaagagcttctcttatacagcctacacaagtgaaatggcagctgatggta
gctagttgtttcagaagaagtggtaactaccaaaaagcattagatacttacaaagatact
cacagaaaatttccagaaaatgtcgaatgtctgcgtttcttagttcgtctctgcacagat
cttggattaaaagatgctcaagaatatgccagaaaactgaagaggttggaaaaaatgaaa
gaaataagggaacagcgcataaagtcaggcagagatggcagtgggggctcccgtggcaaa
agagaaggaagtgctagcggtgatagtggccagaactatagtgccagtagtaaaggtgaa
cgactaagtgccagactcagagctttacctgggacaaatgaaccttatgaaagtagcagt
aacaaagaaatagatgcctcctatgtggacccacttggccctcaaatagaacgaccaaaa
actgcagccaagaaaaggatcgatgaggatgattttgctgatgaagaattaggagatgat
ttgcttccagaataa

DBGET integrated database retrieval system