KEGG   Homo sapiens (human): 81033
Entry
81033             CDS       T01001                                 
Symbol
KCNH6, ERG-2, ERG2, HERG2, Kv11.2, hERG-2
Name
(RefSeq) potassium voltage-gated channel subfamily H member 6
  KO
K04909  potassium voltage-gated channel Eag-related subfamily H member 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    81033 (KCNH6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   81033 (KCNH6)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 PAS_8 PAN_3
Other DBs
NCBI-GeneID: 81033
NCBI-ProteinID: NP_110406
OMIM: 608168
HGNC: 18862
Ensembl: ENSG00000173826
Pharos: Q9H252(Tclin)
UniProt: Q9H252
Position
17:63523358..63548992
AA seq 994 aa
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
NT seq 2985 nt   +upstreamnt  +downstreamnt
atgccggtccgcaggggccacgtcgctccccaaaacacttacctggacaccatcatccgc
aagttcgagggccaaagtcggaagttcctgattgccaatgctcagatggagaactgcgcc
atcatttactgcaacgacggcttctgcgaactcttcggctactcccgagtggaggtgatg
cagcaaccctgcacctgcgacttcctcacaggccccaacacaccaagcagcgccgtgtcc
cgcctagcgcaggccctgctgggggctgaggagtgcaaggtggacatcctctactaccgc
aaggatgcctccagcttccgctgcctggtagatgtggtgcccgtgaagaacgaggacggg
gctgtcatcatgttcattctcaacttcgaggacctggcccagctcctggccaagtgcagc
agccgcagcttgtcccagcgcctgttgtcccagagcttcctgggctccgagggctctcat
ggcaggccaggcggaccagggccaggcacaggcaggggcaagtacaggaccatcagccag
atcccacagttcacgctcaacttcgtggagttcaacttggagaagcaccgctccagctcc
accacggagattgagatcatcgcgccccataaggtggtggagcggacacagaacgtcact
gagaaggtcacccaggtcctgtccctgggcgcggatgtgctgccggagtacaagctgcag
gcgccgcgcatccaccgctggaccatcctgcactacagccccttcaaggccgtgtgggac
tggctcatcctgctgctggtcatctacacggctgtcttcacgccctactcagccgccttc
ctgctcagcgatcaggacgaatcacggcgtggggcctgcagctatacctgcagtcccctc
actgtggtggatctcatcgtggacatcatgttcgtcgtggacatcgtcatcaacttccgc
accacctatgtcaacaccaatgatgaggtggtcagccacccccgccgcatcgccgtccac
tacttcaagggctggttcctcattgacatggtggccgccatccctttcgacctcctgatc
ttccgcactggctccgatgagaccacaaccctgattgggctattgaagacagcgcggctg
ctgcggctggtgcgcgtagcacggaagctggaccgctactctgagtatggggcggctgtg
ctcttcttgctcatgtgcaccttcgcgctcatagcgcactggctggcctgcatctggtac
gccatcggcaatgtggagcggccctacctagaacacaagatcggctggctggacagcctg
ggtgtgcagcttggcaagcgctacaacggcagcgacccagcctcgggcccctcggtgcag
gacaagtatgtcacagccctctacttcaccttcagcagcctcaccagcgtgggcttcggc
aatgtctcgcccaacaccaactccgagaaggtcttctccatctgcgtcatgctcatcggc
tccctgatgtacgccagcatcttcgggaacgtgtccgcgatcatccagcgcctgtactcg
ggcaccgcgcgctaccacacgcagatgctgcgtgtcaaggagttcatccgcttccaccag
atccccaacccactgcgccagcgcctggaggagtatttccagcacgcctggtcctacacc
aatggcattgacatgaacgcggtgctgaagggcttccccgagtgcctgcaggctgacatc
tgcctgcacctgcaccgcgcactgctgcagcactgcccagctttcagcggcgccggcaag
ggctgcctgcgcgcgctagccgtcaagttcaagaccacccacgcgccgcctggggacacg
ctggtgcacctcggcgacgtgctctccaccctctacttcatctcccgaggctccatcgag
atcctgcgcgacgacgtggtcgtggccatcctaggaaagaatgacatctttggggaaccc
gtcagcctccatgcccagccaggcaagtccagtgcagacgtgcgggctctgacctactgc
gacctgcacaagatccagcgggcagatctgctggaggtgctggacatgtacccggccttt
gcggagagcttctggagtaagctggaggtcaccttcaacctgcgggacgcagccgggggt
ctccactcatccccccgacaggctcctggcagccaagaccaccaaggtttctttctcagt
gacaaccagtcagggtctccccatgagctggggccccagttcccctctaagggctacagc
ctcctgggtcctgggagccagaactccatgggggcaggaccttgtgctccagggcaccca
gatgcagcccctcccctgagcatctcagatgcatctggcctctggcctgagctactgcag
gaaatgcccccaaggcacagcccccaaagccctcaggaagacccagattgctggcctctg
aagctgggctccaggctagagcagctccaggcccagatgaacaggctggagtcccgcgtg
tcctcagacctcagccgcatcttgcagctcctccagaagcccatgccccagggccacgcc
agctacattctggaagcccctgcctccaatgacctggccttggttcctatagcctcggag
acgacgagtccagggcccaggctgccccagggctttctgcctcctgcacagaccccaagc
tatggagacttggatgactgtagtccaaagcacaggaactcctcccccaggatgcctcac
ctggctgtggcaacggacaaaactctggcaccatcctcagaacaggaacagcctgagggg
ctctggccacccctagcctcacctctacatcccctggaagtacaaggactcatctgtggt
ccctgcttctcctccctccctgaacaccttggctctgttcccaagcagctggacttccag
agacatggctcagatcctggatttgcagggagttggggccactga

DBGET integrated database retrieval system