KEGG   Homo sapiens (human): 81034
Entry
81034             CDS       T01001                                 

Gene name
SLC25A32, GLYB, MFT, MFTC, RREI
Definition
(RefSeq) solute carrier family 25 member 32
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    81034 (SLC25A32)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   81034 (SLC25A32)
SSDB
Motif
Pfam: Mito_carr E3_UFM1_ligase Repressor_Mnt
Other DBs
NCBI-GeneID: 81034
NCBI-ProteinID: NP_110407
OMIM: 138480
HGNC: 29683
Ensembl: ENSG00000164933
Vega: OTTHUMG00000164790
Pharos: Q9H2D1(Tbio)
UniProt: Q9H2D1
Position
8q22.3
AA seq 315 aa
MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRP
KYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEA
TEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVR
GLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVA
ATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCITFVVY
ENVSHFLLDLREKRK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacgggccagggccagtcggcgtccgggtcgtcggcgtggagcacggtattccgccac
gtccggtatgagaacctgatagcgggcgtgagcggcggcgtcttatccaaccttgcgctg
catccgctcgacctcgtgaagatccgcttcgccgtgagtgatggattggaactgagaccg
aaatataatggaattttacattgcttgactaccatttggaaacttgatggactacgggga
ctttatcaaggagtaaccccaaatatatggggtgcaggtttatcctggggactctacttt
ttcttttacaatgccatcaagtcatataaaacagaaggaagagctgaacgtttagaggca
acagaataccttgtctcagctgctgaagctggagccatgaccctctgcattacaaaccca
ttatgggtaacaaaaactcgccttatgttacagtatgatgctgttgttaactccccacac
cgacaatataaaggaatgtttgatacacttgtgaaaatatataagtatgaaggtgtgcgt
ggattatataagggatttgttcctgggctgtttggaacatcgcatggtgcccttcagttt
atggcatatgaattgctgaagttgaagtacaaccagcatatcaatagattaccagaagcc
cagttgagcacagtagaatatatatctgttgcagcactatccaaaatatttgctgtcgca
gcaacatacccatatcaagtcgtaagagctcgtcttcaggatcaacacatgttttacagt
ggtgtaatagatgtaatcacaaagacatggaggaaagaaggcgtcggtggattttacaag
ggaattgctcctaatttgattagagtgactccagcctgctgtattacctttgtggtatat
gaaaacgtctcacattttttacttgaccttagagaaaagagaaagtaa

DBGET integrated database retrieval system