KEGG   Homo sapiens (human): 8106Help
Entry
8106              CDS       T01001                                 

Gene name
PABPN1, OPMD, PAB2, PABII, PABP-2, PABP2
Definition
(RefSeq) poly(A) binding protein nuclear 1
  KO
K14396  polyadenylate-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Disease
H00704  Oculopharyngeal muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    8106 (PABPN1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    8106 (PABPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8106 (PABPN1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     8106 (PABPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 8106
NCBI-ProteinID: NP_004634
OMIM: 602279
HGNC: 8565
Ensembl: ENSG00000100836
Vega: OTTHUMG00000028739
Pharos: Q86U42(Tbio)
UniProt: Q86U42
Structure
PDB: 

Position
14q11.2
AA seq 306 aa AA seqDB search
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEEL
LLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
SWYSPY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcagcagcagcgggggctgcgggcggtcggggctccggg
ccggggcggcggcgccatcttgtgcccggggccggtggggaggccggggagggggccccg
gggggcgcaggggactacgggaacggcctggagtctgaggaactggagcctgaggagctg
ctgctggagcccgagccggagcccgagcccgaagaggagccgccccggccccgcgccccc
ccgggagctccgggccctgggcctggttcgggagcccccggcagccaagaggaggaggag
gagccgggactggtcgagggtgacccgggggacggcgccattgaggacccggagctggaa
gctatcaaagctcgagtcagggagatggaggaagaagctgagaagctaaaggagctacag
aacgaggtagagaagcagatgaatatgagtccacctccaggcaatgctggcccggtgatc
atgtccattgaggagaagatggaggctgatgcccgttccatctatgttggcaatgtggac
tatggtgcaacagcagaagagctggaagctcactttcatggctgtggttcagtcaaccgt
gttaccatactgtgtgacaaatttagtggccatcccaaagggtttgcgtatatagagttc
tcagacaaagagtcagtgaggacttccttggccttagatgagtccctatttagaggaagg
caaatcaaggtgatcccaaaacgaaccaacagaccaggcatcagcacaacagaccggggt
tttccacgagcccgctaccgcgcccggaccaccaactacaacagctcccgctctcgattc
tacagtggttttaacagcaggccccggggtcgcgtctacaggggccgggctagagcgaca
tcatggtattccccttactaa

DBGET integrated database retrieval system