KEGG   Homo sapiens (human): 811Help
Entry
811               CDS       T01001                                 

Gene name
CALR, CRT, HEL-S-99n, RO, SSA, cC1qR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
Network
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
Disease
H01605  Myelofibrosis
H01612  Essential thrombocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    811 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    811 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    811 (CALR)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    811 (CALR)
   05163 Human cytomegalovirus infection
    811 (CALR)
   05142 Chagas disease (American trypanosomiasis)
    811 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    811 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    811 (CALR)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   811 (CALR)
Lectins [BR:hsa04091]
 Calnexin / calreticulin
  811 (CALR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin DDHD
Motif
Other DBs
NCBI-GeneID: 811
NCBI-ProteinID: NP_004334
OMIM: 109091
HGNC: 1455
Ensembl: ENSG00000179218
Vega: OTTHUMG00000180574
Pharos: P27797(Tbio)
UniProt: P27797 V9HW88
Structure
PDB: 

Position
19p13.13
AA seq 417 aa AA seqDB search
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgcc
gtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatcc
aaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgag
gagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagt
ttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgag
cagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagaca
gacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaac
acctatgaggtgaagattgacaacagccaggtggagtccggctccttggaagacgattgg
gacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggat
gagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgag
catatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagag
tgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatc
gacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattct
cccgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgag
gagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaa
caggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggag
gaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggac
aaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtag

DBGET integrated database retrieval system