KEGG   Homo sapiens (human): 81282Help
Entry
81282             CDS       T01001                                 

Gene name
OR51G2, OR11-28
Definition
(RefSeq) olfactory receptor family 51 subfamily G member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    81282 (OR51G2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    81282 (OR51G2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    81282 (OR51G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Herpes_LMP1
Motif
Other DBs
NCBI-GeneID: 81282
NCBI-ProteinID: NP_001005238
HGNC: 15198
Ensembl: ENSG00000176893
Vega: OTTHUMG00000066501
Pharos: Q8NGK0(Tdark)
UniProt: Q8NGK0
Position
11p15.4
AA seq 314 aa AA seqDB search
MTLGSLGNSSSSVSATFLLSGIPGLERMHIWISIPLCFMYLVSIPGNCTILFIIKTERSL
HEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFFIHCFSFLESSVL
LSMAFDRFVAICHPLHYVSILTNTVIGRIGLVSLGRSVALIFPLPFMLKRFPYCGSPVLS
HSYCLHQEVMKLACADMKANSIYGMFVIVSTVGIDSLLILFSYALILRTVLSIASRAERF
KALNTCVSHICAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFMYLLFPPVMNPIVYSVK
TKQIRDRVTHAFCY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgggatccctgggaaacagcagcagcagcgtttctgctaccttcctgctgagt
ggcatccctgggctggagcgcatgcacatctggatctccatcccactgtgcttcatgtat
ctggtttccatcccgggcaactgcacaattctttttatcattaaaacagagcgctcactt
catgaacctatgtatctcttcctgtccatgctggctctgattgacctgggtctctccctt
tgcactctccctacagtcctgggcatcttttgggttggagcacgagaaattagccatgat
gcctgctttgctcagctctttttcattcactgcttctccttcctcgagtcctctgtgcta
ctgtctatggcctttgaccgctttgtggctatctgccaccccttgcactatgtttccatt
ctcaccaacacagtcattggcaggattggcctggtctctctgggtcgtagtgtagcactc
atttttccattaccttttatgctcaaaagattcccctattgtggctccccagttctctca
cattcttattgtctccaccaagaagtgatgaaattggcctgtgccgacatgaaggccaac
agcatctacggcatgtttgtcatcgtctctacagtgggtatagactcactgctcatcctc
ttctcttatgctctgatcctgcgcaccgtgctgtccatcgcctccagggctgagagattc
aaggcccttaacacctgtgtttcccacatctgtgctgtgctgctcttctacactcccatg
attggcctctctgtcatccatcgctttggaaagcaggcaccccacctggtccaggtggtc
atgggtttcatgtatcttctctttcctcctgtgatgaatcccattgtctacagtgtgaag
accaaacagatccgggatcgagtgacgcatgccttttgttactaa

DBGET integrated database retrieval system