KEGG   Homo sapiens (human): 81309Help
Entry
81309             CDS       T01001                                 

Gene name
OR4C15, OR11-127, OR11-134
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 15
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    81309 (OR4C15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    81309 (OR4C15)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    81309 (OR4C15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81309
NCBI-ProteinID: NP_001001920
HGNC: 15171
Ensembl: ENSG00000181939
Vega: OTTHUMG00000166714
Pharos: Q8NGM1(Tdark)
UniProt: Q8NGM1 A0A2C9F2M4
Position
11q11
AA seq 316 aa AA seqDB search
MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF
FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD
RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL
YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG
SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI
WNRLMVVSDEKENIKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaaagctttgtaactgagtttgtcctcctgggactttcacagaatccaaat
gttcaggaaatagtatttgttgtatttttgtttgtctacattgcaactgttgggggcaac
atgctaattgtagtaaccattctcagcagccctgctcttctggtgtctcctatgtacttc
ttcttgggcttcctgtccttcctggatgcgtgcttctcatctgtcatcaccccaaagatg
attgtagactccctctatgtgacaaaaaccatctcttttgaaggctgcatgatgcagctc
tttgctgaacacttctttgctggggtggaggtgattgtcctcacagccatggcctatgat
cgttatgtggccatttgcaagcccttgcattactcttctatcatgaacaggaggctctgt
ggcattctgatgggggtagcctggacagggggcctcttgcattccatgatacaaattctt
tttactttccagcttcccttttgtggccccaatgtcatcaatcactttatgtgtgacttg
tacccgttactggagcttgcctgcactgatactcacatctttggcctcatggtggtcatc
aacagtgggtttatctgcatcataaacttctccttgttgcttgtctcctatgctgtcatc
ttgctctctctgagaacacacagttctgaagggcgctggaaagctctctccacctgtgga
tctcacattgctgttgtgattttgttctttgtcccatgcatatttgtatatacacgacct
ccatctgctttttcccttgacaaaatggcggcaatattttatatcatcttaaatcccttg
ctcaatcctttgatttacactttcaggaataaggaagtaaaacaggccatgaggagaata
tggaacagactgatggtggtttctgatgagaaagaaaatattaaactttaa

DBGET integrated database retrieval system