KEGG   Homo sapiens (human): 81448Help
Entry
81448             CDS       T01001                                 

Gene name
OR6K2, OR1-17
Definition
(RefSeq) olfactory receptor family 6 subfamily K member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    81448 (OR6K2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    81448 (OR6K2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    81448 (OR6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81448
NCBI-ProteinID: NP_001005279
HGNC: 15029
Ensembl: ENSG00000196171
Vega: OTTHUMG00000022768
Pharos: Q8NGY2(Tdark)
UniProt: Q8NGY2 A0A126GV58
Position
1q23.1
AA seq 324 aa AA seqDB search
MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY
TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD
HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF
LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS
TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE
AIKKHIGQAKIFFSVRPGTSSKIF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagagccccaatcgaaccaccattcaggagtttatcttctccgctttcccttattcc
tgggttaagtctgttgtctgctttgttccactgctcttcatctatgctttcattgttgtt
ggaaacctggtcatcatcacagtggtccagttgaatactcacctccacactcccatgtat
acttttatcagtgctctttctttcctggagatttggtataccacagccacaatcccaaag
atgctgtctagcctgcttagtgagaggagcatttccttcaatggttgtctcctgcagatg
tatttcttccattccaccggcatctgtgaggtgtgtctcttgacagttatggcctttgac
cactacctggccatatgcagccctcttcattatccctctatcatgacccccaagctatgt
acccaactgactttaagttgctgtgtttgtggctttatcacaccccttcctgagattgcc
tggatctctacactgccattttgtggttcgaatcaccttgaacatatcttctgtgacttc
ctcccagtgctgcgtctggcctgcacagacacacgagccatcgtcatgattcaggtagtg
gatgtcattcatgcagtggagattattacagctgtgatgctcatcttcatgtcctacgat
ggtattgtggctgtaattctacgtattcattcagctggaggccgccgcacagcattttcc
acgtgtgtctctcacttcattgtcttttcgctcttctttggcagtgtgactctcatgtac
ctacgcttctctgccacctactctttgttctgggatatagccattgctctggcctttgca
gttttgtctcccttcttcaaccccattatctatagcctgaggaataaagaaataaaagaa
gctataaaaaagcacataggtcaagctaagatatttttttccgtaagaccagggacctca
agtaagatattttag

DBGET integrated database retrieval system