KEGG   Homo sapiens (human): 8148Help
Entry
8148              CDS       T01001                                 

Gene name
TAF15, Npl3, RBP56, TAF2N, TAFII68
Definition
(RefSeq) TATA-box binding protein associated factor 15
  KO
K14651  transcription initiation factor TFIID subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    8148 (TAF15)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8148 (TAF15)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     8148 (TAF15)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     8148 (TAF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-RanBP
Motif
Other DBs
NCBI-GeneID: 8148
NCBI-ProteinID: NP_631961
OMIM: 601574
HGNC: 11547
Ensembl: ENSG00000270647
Vega: OTTHUMG00000188384
Pharos: Q92804(Tbio)
UniProt: Q92804
Structure
PDB: 

Position
17q12
AA seq 592 aa AA seqDB search
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattctggaagttacggtcagtctgggggtgagcagcaaagttattctacctat
ggaaatccaggcagccaaggctatggacaagcatcacaaagctattctggctatgggcaa
acgactgattcctcttatggacagaactacagcggttactccagttatggacaaagtcag
tcaggttattcacagtcctatggtggttatgagaatcaaaagcagagctcatatagccag
caaccatataataaccagggacagcagcaaaacatggaatcatcaggaagccaaggtgga
agagcaccttcctatgaccagccagactatggtcaacaagattcatatgaccagcagtca
ggctatgatcaacatcaaggctcatatgatgagcagtcaaattatgatcagcagcatgat
tcctatagtcaaaaccagcagtcctatcattcacaaagggaaaactacagccaccacaca
caagatgaccgtcgtgatgtgagtaggtatggagaagataatagaggatatggcgggtca
cagggaggaggtagagggcgtgggggatatgacaaggatggaagaggtcctatgacagga
tcaagtggtggtgaccgcggtggcttcaaaaattttggtggtcacagggattatggaccc
agaacagatgctgattcagaatctgataattcagataacaacacaatctttgtgcaagga
cttggggagggtgtgtctacagatcaagttggggagttctttaaacaaataggaattatc
aagacaaataagaagaccggaaaaccaatgataaatctttatacagacaaggacacagga
aagccaaagggggaggcaacagtgtcatttgatgaccctccttcagctaaggcagccatt
gactggtttgatggaaaagaattccatggcaacatcattaaagtgtcctttgccactaga
agacctgaattcatgagaggaggtggaagtggaggtgggcggcgaggccgtggaggatat
agaggtcgtggaggctttcaagggagaggtggagaccccaaaagtggggattgggtttgc
cctaatccgtcatgcggaaatatgaactttgctcgaaggaattcctgcaatcagtgcaat
gagcctagaccagaggactctcgtccctcaggaggagatttccgggggagaggctacggt
ggagagaggggctacagaggtcgtgggggcagaggtggagaccgaggcggctatggtgga
gacagaagtgggggtggctatggtggagacagaagcagcggtggtggctacagcggagat
agaagtgggggcggctatggtggagacagaagtgggggtggctatggtggggacagaggc
ggcggctatggtggggacagaggaggcggctatggaggagaccgaggaggtggctatgga
ggagatcgaggtggctatggaggagaccgaggtggaggctatggtggagaccgaggaggc
tatggaggagatcgaggaggttacggaggagatcgaggaggttatggaggagatcgagga
ggctatggaggagacagaagccgggggggctatggaggagaccgtggtggtggcagtggc
tacggtggagaccgaagtggaggctatggaggagacaggagtggtggcggctatggagga
gaccgaggtgggggctacggaggagaccgaggtggctatggaggcaaaatgggaggaaga
aacgactacagaaatgatcagcgcaaccgaccatactga

DBGET integrated database retrieval system