KEGG   Homo sapiens (human): 81491Help
Entry
81491             CDS       T01001                                 

Gene name
GPR63, PSP24(beta), PSP24B
Definition
(RefSeq) G protein-coupled receptor 63
  KO
K04321  G protein-coupled receptor 63
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    81491 (GPR63)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    81491 (GPR63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF5527
Motif
Other DBs
NCBI-GeneID: 81491
NCBI-ProteinID: NP_001137429
OMIM: 606915
HGNC: 13302
Ensembl: ENSG00000112218
Vega: OTTHUMG00000015245
Pharos: Q9BZJ6(Tdark)
UniProt: Q9BZJ6 A8K1C4
Position
6q16.1
AA seq 419 aa AA seqDB search
MVFSAVLTAFHTGTSNTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLT
VNSTAVPTTPAAFKSLNLPLQITLSAIMIFILFVSFLGNLVVCLMVYQKAAMRSAINILL
ASLAFADMLLAVLNMPFALVTILTTRWIFGKFFCRVSAMFFWLFVIEGVAILLIISIDRF
LIIVQRQDKLNPYRAKVLIAVSWATSFCVAFPLAVGNPDLQIPSRAPQCVFGYTTNPGYQ
AYVILISLISFFIPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQASKLGLMSLQRPF
QMSIDMGFKTRAFTTILILFAVFIVCWAPFTTYSLVATFSKHFYYQHNFFEISTWLLWLC
YLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPQLPGHTKRRIRPSAVYVCGEHRTVV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtcttctcggcagtgttgactgcgttccataccgggacatccaacacaacatttgtc
gtgtatgaaaacacctacatgaatattacactccctccaccattccagcatcctgacctc
agtccattgcttagatatagttttgaaaccatggctcccactggtttgagttccttgacc
gtgaatagtacagctgtgcccacaacaccagcagcatttaagagcctaaacttgcctctt
cagatcaccctttctgctataatgatattcattctgtttgtgtcttttcttgggaacttg
gttgtttgcctcatggtttaccaaaaagctgccatgaggtctgcaattaacatcctcctt
gccagcctagcttttgcagacatgttgcttgcagtgctgaacatgccctttgccctggta
actattcttactacccgatggatttttgggaaattcttctgtagggtatctgctatgttt
ttctggttatttgtgatagaaggagtagccatcctgctcatcattagcatagataggttc
cttattatagtccagaggcaggataagctaaacccatatagagctaaggttctgattgca
gtttcttgggcaacttccttttgtgtagcttttcctttagccgtaggaaaccccgacctg
cagataccttcccgagctccccagtgtgtgtttgggtacacaaccaatccaggctaccag
gcttatgtgattttgatttctctcatttctttcttcatacccttcctggtaatactgtac
tcatttatgggcatactcaacacccttcggcacaatgccttgaggatccatagctaccct
gaaggtatatgcctcagccaggccagcaaactgggtctcatgagtctgcagagacctttc
cagatgagcattgacatgggctttaaaacacgtgccttcaccactattttgattctcttt
gctgtcttcattgtctgctgggccccattcaccacttacagccttgtggcaacattcagt
aagcacttttactatcagcacaacttttttgagattagcacctggctactgtggctctgc
tacctcaagtctgcattgaatccgctgatctactactggaggattaagaaattccatgat
gcttgcctggacatgatgcctaagtccttcaagtttttgccgcagctccctggtcacaca
aagcgacggatacgtcctagtgctgtctatgtgtgtggggaacatcggacggtggtgtga

DBGET integrated database retrieval system