KEGG   Homo sapiens (human): 81492Help
Entry
81492             CDS       T01001                                 

Gene name
RSPH6A, RSHL1, RSP4, RSP6, RSPH4B
Definition
(RefSeq) radial spoke head 6 homolog A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Radial_spoke Dpy-30
Motif
Other DBs
NCBI-GeneID: 81492
NCBI-ProteinID: NP_110412
OMIM: 607548
HGNC: 14241
Ensembl: ENSG00000104941
Vega: OTTHUMG00000182482
Pharos: Q9H0K4(Tdark)
UniProt: Q9H0K4
Position
19q13.32
AA seq 717 aa AA seqDB search
MGDLPPYPERPAQQPPGRRTSQASQRRHSRDQAQALAADPEERQQIPPDAQRNAPGWSQR
GSLSQQENLLMPQVFQAEEARLGGMEYPSVNTGFPSEFQPQPYSDESRMQVAELTTSLML
QRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSEL
GFPHYSAQVPEPEPLELAVQNAKAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVL
ESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETP
VPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEV
EFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIVPKSVWKPPPVIPKEESR
SGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANY
LRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVDSMAN
WVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAE
IMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPA
LPAPIQQEYPSGPEIMEMSDPTVEEEQALKAAQEQALGATEEEEEGEEEEEGEETDD
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgggagacctgccgccctaccctgagcgccctgcccagcagcctccgggccggaggact
tctcaggcctcccagaggcggcacagtcgggaccaagctcaggccctggcagcggacccc
gaggagaggcagcagatacctccagacgcccagcgaaacgcccctggttggtcacagagg
ggcagcctgtcccaacaggagaacttgctgatgccccaggtcttccaggctgaggaagcc
cggctgggtggcatggagtacccatctgtgaacacgggctttccctcagagttccagcct
cagccttactctgatgaaagcaggatgcaggtcgccgagctcaccaccagcctaatgctg
cagcggctccagcagggccaaagcagcctgttccagcaactggaccccaccttccaggag
cccccagtcaaccccttgggccagttcaacctctaccagacagaccagttctctgaaggt
gcccagcacgggccttacataagggatgaccctgcccttcagttcttgccctctgagctg
ggcttcccacactacagtgcccaggtgcctgagcccgagcctctggagctggccgtgcag
aacgccaaggcctacctgctgcagaccagcatcaattgcgacctcagcctgtacgagcac
ctggtgaatctgctgaccaagatcctgaaccagcggcctgaggaccccttgtctgtcctg
gagtctctgaaccgcaccacgcagtgggagtggttccaccccaagctggacacgctgcgg
gacgaccccgagatgcagcccacctacaagatggcggagaaacagaaggcgctgttcacc
cggagtggaggcggcactgaaggcgaacaggagatggaggaggaggtgggggagacacca
gtgcccaacatcatggagactgccttctacttcgagcaggccggcgtcggcctgagctcg
gacgagagcttccgcattttcctggccatgaaacagctggtggagcagcagcccatccac
acctgtcgcttctggggcaagatcctgggaatcaaacgcagctacctggtggccgaggtg
gaattccgggagggcgaggaggaggcagaggaggaggaggtggaggagatgacggaaggt
ggcgaggtcatggaggcgcacggcgaggaggagggcgaggaggacgaggagaaggccgtg
gacatcgtccctaagtccgtatggaagccgccgcccgtgatccccaaggaggagagccgc
tcaggcgccaacaagtacctgtactttgtgtgcaacgagccgggcctgccatggacgcgg
ctgccccacgtcactccagcccagatcgtgaacgcccgaaagatcaagaagttcttcaca
ggctacctggacacgccagtcgtcagctacccacccttcccgggcaacgaggccaactac
ctgcgggcccagatagcccgcatctcggccgccacgcaggtcagcccgctgggcttctac
cagtttagtgaggaggagggcgacgaggaggaggaaggtggtgctgggcgcgactcctac
gaggagaacccggacttcgagggcatccccgtgctggagctggtcgactccatggccaac
tgggtgcatcacacacagcacatcctgccgcagggccgctgcacttgggtgaaccctttg
cagaagacagaggaggaggaggacctgggggaggaggaagagaaggcagatgaggggcca
gaggaggtggagcaggaggttggccccccactgctaacgccactttcagaagatgcagaa
atcatgcacctggcaccctggaccacccgcctgtcctgcagcctctgcccgcagtactca
gtggccgttgtgcgctccaacctctggcccggggcctatgcctatgccagtggcaaaaag
tttgagaacatctacatcggctggggtcacaagtacagccccgagagcttcaacccggcc
ctgccagcccccattcaacaagagtaccccagtggcccagagatcatggagatgagtgac
cccacagtggaagaggagcaggctctgaaagcagcccaggaacaagccctgggagccaca
gaggaggaggaggagggcgaggaggaggaggagggcgaggagacagatgactga

DBGET integrated database retrieval system