KEGG   Homo sapiens (human): 81545Help
Entry
81545             CDS       T01001                                 

Gene name
FBXO38, Fbx38, HMN2D, MOKA, SP329
Definition
(RefSeq) F-box protein 38
  KO
K10313  F-box protein 38
Organism
hsa  Homo sapiens (human)
Disease
H00856  Distal hereditary motor neuropathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    81545 (FBXO38)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     81545 (FBXO38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box F-box-like
Motif
Other DBs
NCBI-GeneID: 81545
NCBI-ProteinID: NP_110420
OMIM: 608533
HGNC: 28844
Ensembl: ENSG00000145868
Vega: OTTHUMG00000129929
Pharos: Q6PIJ6(Tbio)
UniProt: Q6PIJ6 Q6AZE0
Position
5q32
AA seq 1113 aa AA seqDB search
MGPRKKSVKTCIMNNEIPEEMTADETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDASFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADA
LNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSES
DDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQS
KQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSTTASTVGNSSSHNT
ASQSPDFVRTVNSGGSSEPSPTEVDVSRQCACSPGGSEDSEAMEEGDAESSVCPRCCCHR
PQESQRRTSRCSDEERPSTSRACVVNGPDEVAKTKPRHAMKRKRTADKSTSTSDPVIEDD
HVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDY
AQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSN
PPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEEDLKKYPKYPWGREIYTLEGVVD
GAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEIS
EMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggggccacgaaagaaaagtgtgaaaacatgtatcatgaataatgaaattccagaagaa
atgacagcagatgaaacaaaggactatatgaatcaactttcacatgaagtactttgccat
atttttaggtacctccctctgcaggatatcatgtgtatggaatgtctttcccggaagcta
aaggaagcagtgaccctatatctgcgagttgtgagagttgtagatctctgtgcagggcgg
tggtgggaatacatgccaagtggctttacagatgccagttttctaacactattaaagaag
atgccagatgttgaacagctatatggccttcaccctcgataccttgagaggcgaagagta
aggggccatgaggcttttagcattccaggagtcctagaagctttgcaggcatgcccaaac
ttagtgggtgtggaaacttctcatttggagttggtagaatccatttggacatatatgccc
catgttcatattttggggaaatttcgtaatcgtaatggagcttttccaattcctcctgaa
aataaactgaaaattcctataggagccaaaattcaaactttacatttagttggggtgaat
gttcctgaaattccttgtatcccaatgctaaggcacctttatatgaagtgggtaagactc
actaaaccacagccatttaaagacttcctttgtatcagcttaagaactttcgtcatgagg
aactgtgcaggacccacaaattccttgaaatatgtccctttagtaacaggcttagcctct
gcccgaaacttggaacacttagaaatggttcgagttcctttccttggaggtcttatccaa
catgttgttgaagacagttggagatcaggtggttttagaaatttgcacactattgttctg
ggagcttgcaaaaatgctcttgaagtagatcttggttacctcatcattactgctgcccgt
aggttacatgaagttcggatccagccttccctaaccaaagatggtgtcttttctgcccta
aagatggcagagttggagtttccccagtttgaaacccttcatctaggatatgtagatgag
tttttgctacagagcagaatggctaatgcggatctggtgaagtatggtttggctgatgtg
gtagaaaatcctggtatcatcactgatatagggatgaaagcagtcaatgaagttttttcc
tgtatcaaatatctggcaatttacaattgccctcatctacacaacccatacaattggatc
tcagaccactcaagatggactcgattggttgatatcaacctagtacggtgccatgctttg
aagctggactcttttggccagtttattgaattattacccagcctagagtttatttcactg
gatcagatgtttcgtgaaccacccaagggttgtgctcgagttggtctgagtgcaggcaca
ggaattggtgtttcatcagctcttgttagcaaccagaactccaacaatgacgataataat
gcccagaataacaatgccaacatccacgacaacaatcaccatcatccagatgactcagac
gaggagaatgactttcggcaagatctgcagccaggagagcagcagtttgcagctgacgca
ttaaatgagatggaagacatcgtccaagaagatggagaggtggtggccgagagtggaaat
aatactccagctcacagccaggcaattattcctgtggatgttgatgaggaacaagcagga
cccagtggtcttcagcgtgtagtaaaaccaacctcaattactgttcatgattcagagagt
gatgatgaagaagatagtctagaactccaagaagtctggattcctaagaacggtactcgg
cgttactctgaacgtgaagaaaaaactggagagtcagtgcagtccagagaattgtcagta
agtggaaaaggcaagactccacttcgaaagaggtacaactcccatcagatgggccagtcg
aagcagtttcccctcgaggaaagcagctgtgagaaaggctgtcaggtcaccagtgagcag
atcaaagccgatatgaaagcagctagggatattcctgaaaagaaaaaaaacaaggatgtt
tatcccagctgcagcagcaccaccgccagcacagtgggaaactccagctcacacaacact
gcttctcaaagccccgactttgtaaggacggtgaacagcggcggctcttccgagcctagc
cctacagaagtggatgtgtccaggcagtgtgcctgctcccccggtgggtcagaggactct
gaggccatggaggagggagatgcagagagttctgtctgccccagatgctgctgtcacagg
ccccaggaatcccaaaggagaactagcaggtgttctgatgaggaacgtccttcaaccagc
cgagcctgtgttgtgaatggcccggatgaagtagccaaaacaaagccacgtcacgccatg
aaacggaagcggacagcagataaatccactagtacaagtgatcctgtgatcgaggatgac
catgtgcaggttcttgtattaaaatccaagaatcttgttggagtcactatgaccaattgt
ggaatcacagatctagtgctaaaagactgtccaaagatgatgttcatccatgctaccagg
tgcagggtactaaaacatttaaaggtagaaaatgcaccaattgtaaaccgatttgactat
gcacagtgcaagaaactgaacatggatcaggtactagaccagatactaagaatgccaccc
gagagaaaccgcatcatatacctacgcccaatgcagcaggtggacactctaactttggag
cagaagctatttagtggtccctacccctatcacatctgtattatccatgaattcagtaac
cctcccaatgtccggaataaggtgcgcattcgcagctggatggacactatagcaaacatc
aatcaagagctcattaaatatgaattcttccctgaagccactcgaagtgaagaagactta
aagaaataccccaagtacccctgggggagagaaatctatactttagaaggtgttgtggat
ggagctccatattccatgatttctgacttcccttggctgaggtcattacgagctgcagag
cccaacagcttcgctcgatacgactttgaagacgatgaagaaagcactatctatgctcct
agaaggaaaggacagctgtctgcagacatctgtatggaaacaataggagaggaaatttca
gagatgcgtcagatgaagaagggtgtatttcagcgagtagtggcaatttttatccactat
tgtgatgtcaatggagagccagttgaagatgactacatttaa

DBGET integrated database retrieval system