KEGG   Homo sapiens (human): 81550
Entry
81550             CDS       T01001                                 
Symbol
TDRD3
Name
(RefSeq) tudor domain containing 3
  KO
K18404  tudor domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    81550 (TDRD3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    81550 (TDRD3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     81550 (TDRD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    81550 (TDRD3)
SSDB
Motif
Pfam: RMI1_N_C TUDOR UBA_7 UBA SMN_Tudor UBA_8 SGF29_Tudor HYPK_UBA
Other DBs
NCBI-GeneID: 81550
NCBI-ProteinID: NP_001139543
OMIM: 614392
HGNC: 20612
Ensembl: ENSG00000083544
UniProt: Q9H7E2
Position
13:60395533..60573879
AA seq 651 aa
MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGE
VEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMP
VKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKST
KSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVM
GPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQ
YRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGSGLPRNRGSER
PSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSF
AEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTD
YQNPVRSNSFIGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKP
EKILESSIPMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEV
LLSNIKPIQTEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRARN
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgctgcgattacagatgactgatggtcatataagttgcacagcagtagaatttagttat
atgtcaaaaataagcctgaacacaccacctggaactaaagttaagctctcaggcattgtt
gacataaaaaatggattcctgctcttgaatgactctaacaccacagttcttggtggtgaa
gtggaacaccttattgagaaatgggagttacagagaagcttatcaaaacacaatagaagc
aatattggaactgaaggtggaccaccgccttttgtgccttttggacagaagtgtgtatct
catgtccaagtggatagcagagaacttgatcgaagaaaaacattgcaagttacaatgcct
gtcaaacctacaaatgataatgatgaatttgaaaagcaaaggacggctgctattgctgaa
gttgcaaagagcaaggaaaccaagacatttggaggaggtggtggtggtgctagaagtaat
ctcaatatgaatgctgctggtaaccgaaatagggaagttttacagaaagaaaagtcaacc
aaatcagagggaaaacatgaaggtgtctatagagaactggttgatgagaaagctctgaag
cacataacggaaatgggcttcagtaaggaagcatcgaggcaagctcttatggataatggc
aacaacttagaagcagcactgaacgtacttcttacaagcaataaacagaaacctgttatg
ggtcctcctctgagaggtagaggaaaaggcagggggcgaataagatctgaagatgaagag
gacctgggaaatgcaaggccatcagcaccaagcacattatttgatttcttggaatctaaa
atgggaactttgaatgtggaagaacctaaatcacagccacagcagcttcatcagggacaa
tacagatcatcaaatactgagcaaaatggagtaaaagataataatcatctgagacatcct
cctcgaaatgataccaggcagccaagaaatgaaaaaccgcctcgttttcaaagagactcc
caaaattcaaagtcagttttagaaggcagtggattacctagaaatagaggttctgaaaga
ccaagtacttcttcagtatctgaagtatgggctgaagacagaatcaaatgtgatagaccg
tattctagatatgacagaactaaagatacttcatatcctttaggttctcagcatagtgat
ggtgcttttaaaaaaagagataactctatgcaaagcagatcaggaaaaggtccctccttt
gcagaggcaaaagaaaatccacttcctcaaggatctgtagattataataatcaaaaacgt
ggaaaaagagaaagccaaacatctattcctgattatttttatgacaggaaatcacaaaca
ataaataatgaagctttcagtggtataaaaattgaaaaacattttaatgtaaatactgat
tatcagaatccagttcgaagtaatagtttcattggtgttccaaatggagaagtagaaatg
ccactgaaaggaagacgaataggacctattaagccagcaggacctgtcacagctgtaccc
tgtgatgataaaatattttacaatagtgggcccaaacgaagatctgggccaattaagcca
gaaaaaatactagaatcatctattcctatggagtatgcaaaaatgtggaaacctggagat
gaatgttttgcactttattgggaagacaacaagttttaccgggcagaagttgaagccctc
cattcttcgggtatgacagcagttgttaaattcattgactacggaaactatgaagaggtg
ctactgagcaatatcaagcccattcaaacagaggcatgggaggaagaaggcacctacgat
caaactctggagttccgtaggggaggtgatggccagccaagacgatccactcggccaacc
caacagttttaccaaccaccccgggctcggaactaa

DBGET integrated database retrieval system