KEGG   Homo sapiens (human): 81551Help
Entry
81551             CDS       T01001                                 

Gene name
STMN4, RB3
Definition
(RefSeq) stathmin 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin Pex19 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 81551
NCBI-ProteinID: NP_001269983
HGNC: 16078
Ensembl: ENSG00000015592
Vega: OTTHUMG00000099461
Pharos: Q9H169(Tbio)
UniProt: Q9H169
Structure
PDB: 

Position
8p21.2
AA seq 189 aa AA seqDB search
MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
KELKEEASR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgctgcctacaaagagaagatgaaggagctcccgctggtgtccttgttctgc
tcctgcttcctggccgatcccctgaataagtcgtcctacaaatatgaagcagacacggtg
gacctgaattggtgcgtcatttccgacatggaagtcatcgagctgaacaaatgcacctcg
ggccaatcctttgaagtcatcctgaagccaccctcctttgatggggttcccgagttcaac
gcctccctgccaaggcggcgagacccatccctggaagagatccagaagaaactagaagcg
gctgaggagcgaaggaagtaccaggaagcggagctcctgaaacacctagcagagaaacgg
gaacatgagagagaggtgatccaaaaggccattgaggaaaacaacaacttcatcaagatg
gctaaggaaaaactggcccagaagatggaatccaacaaggagaacagggaggcccacctc
gccgccatgttggaacggctgcaagagaaggacaagcacgccgaggaggtgcggaaaaac
aaggagctgaaggaagaggcctccaggtaa

DBGET integrated database retrieval system