KEGG   Homo sapiens (human): 81554
Entry
81554             CDS       T01001                                 

Symbol
RCC1L, WBSCR16
Name
(RefSeq) RCC1 like
  KO
K23495  RCC1-like G exchanging factor-like protein
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    81554 (RCC1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    81554 (RCC1L)
SSDB
Motif
Pfam: RCC1 RCC1_2
Other DBs
NCBI-GeneID: 81554
NCBI-ProteinID: NP_110425
HGNC: 14948
Ensembl: ENSG00000274523
Vega: OTTHUMG00000130373
Pharos: Q96I51(Tdark)
UniProt: Q96I51
Structure
PDB: 
5XGS

Position
7q11.23
AA seq 464 aa
MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADR
VFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTL
LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS
CGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQD
HSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSA
DGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAVLNGEGHVFVW
GYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGK
NIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcgctggtggcgttggtggctggggctcggctggggcggcggctgagcgggccgggg
ctggggcgagggcactggacggcggccgggcgctcccggagccggcgcgaagcggcagaa
gccgaggcggaggtgcccgtggtccagtacgtgggcgagcgcgctgcccgcgccgatcgc
gtcttcgtgtggggcttcagcttctcgggggcgctgggcgtgccttcctttgtggtgccc
agctccgggcccgggccccgcgccggcgcccgaccgcgccgcaggatccagcccgtgccc
tatcgcctggagctggaccaaaagatttcatctgctgcttgcggctatggattcacactg
ctgtcctctaagactgcggatgttacgaaagtctgggggatgggactcaacaaagattct
cagcttggatttcacaggagccggaaagataaaacgaggggctacgagtatgtgttggag
ccctcacccgtctccctgcctctggacagacctcaggagacacgggtgctgcaggtctcc
tgcggccgagctcactctcttgtgttgactgacagggaaggagtcttcagcatgggaaac
aattcttatgggcaatgtggaagaaaggtggtcgaaaatgaaatttacagtgaaagtcac
agagtccacaggatgcaggacttcgatggccaggtggtccaggtcgcctgtggtcaggat
catagtctgttcctgacggataaaggagaagtctattcttgtggatggggtgctgatggg
caaacaggtctgggtcactacaatatcaccagctcgcccaccaagctgggtggagacctg
gcgggagtgaacgttatccaagttgccacctacggtgattgctgcctggccgtgtccgcc
gacggaggactttttggttggggaaactcggagtacctgcagctggcctctgtcactgac
tccacacaggtgaatgtgccccgctgcttacacttctcaggagtggggaaggtgcgacag
gctgcatgcggtggcacgggctgtgcagtgttaaacggagaaggacatgtttttgtctgg
ggctatggaattcttgggaaaggtccaaacctagtggaaagtgccgtccctgaaatgatt
ccacccactctctttggcttgacggagttcaacccagaaatccaggtttcccgcatccga
tgtggactcagccactttgctgcactgaccaacaaaggagagctgtttgtatggggcaag
aacatccgagggtgcctgggaatcggtcgcctggaggaccagtatttcccatggagggtg
acgatgcctggggagcctgtggacgtggcatgtggcgtggaccacatggtgaccctggcc
aagtcattcatctaa

DBGET integrated database retrieval system