KEGG   Homo sapiens (human): 81559
Entry
81559             CDS       T01001                                 
Symbol
TRIM11, BIA1, RNF92
Name
(RefSeq) tripartite motif containing 11
  KO
K10650  tripartite motif-containing protein 11 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    81559 (TRIM11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     81559 (TRIM11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    81559 (TRIM11)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-B_box zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 zf-RING_5 zf-RING_6 Prok-RING_4 zf-RING_10 DUF3106 U-box zf-Nse TRAF3_RING Sina_RING
Other DBs
NCBI-GeneID: 81559
NCBI-ProteinID: NP_660215
OMIM: 607868
HGNC: 16281
Ensembl: ENSG00000154370
UniProt: Q96F44
Structure
Position
1:complement(228393676..228406835)
AA seq 468 aa
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIAELEGRCQLPA
LGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggccgcccccgacctgtccaccaacctccaggaggaggccacctgcgccatctgcctc
gactacttcacggatccggtgatgaccgactgcggccacaacttctgccgcgagtgcatc
cggcgctgctggggccagcccgagggcccgtacgcgtgccccgagtgccgcgagctgtcc
ccgcagaggaacctgcggcccaaccgcccgcttgctaagatggccgagatggcgcggcgc
ctgcacccgccgtcgccggtcccgcagggcgtgtgccccgcgcaccgcgagccactggcc
gccttctgtggcgacgagctgcgcctcctgtgtgcggcctgcgagcgctctggggagcac
tgggcgcaccgcgtgcggccgctgcaggacgcggccgaagacctcaaggcgaagctggag
aagtcactggagcatctccggaagcagatgcaggatgcgttgctgttccaagcccaggcg
gatgagacctgcgtcttgtggcagaagatggtggagagccagcggcagaacgtgctgggt
gagttcgagcgtcttcgccgtttgctggcagaggaggagcagcagctgctgcagaggctg
gaggaggaggagctggaggtgctgccccggctgcgggagggcgcagcccacctaggccag
cagagcgcccacctagctgagctcatcgccgagctcgagggccgctgccagctgcctgct
ctggggctgctgcaggacatcaaggacgccctgcgcagggtccaggatgtgaagctgcag
cccccagaagttgtgcctatggagctgaggaccgtgtgcagggtcccgggactggtagag
acactgcggaggtttcgaggggacgtgaccttggacccggacaccgccaaccctgagctg
atcctgtctgaagacaggcggagcgtgcagcggggggacctacggcaggccctgccggac
agcccagagcgctttgaccccggcccctgcgtgctgggccaggagcgcttcacctcaggc
cgccactactgggaggtggaggttggggaccgcaccagctgggccctgggggtgtgcagg
gagaacgtgaacaggaaggagaagggcgagctgtccgcgggcaacggcttctggatcctg
gtcttcctggggagctattacaattcctcggaacgggccttggctccactccgggaccca
cccaggcgcgtggggatctttctggactacgaggctggacatctctctttctacagtgcc
accgatgggtcactgctattcatctttcccgagatccccttctcggggacgctgcggccc
ctcttctcacccctgtccagcagcccgaccccgatgactatctgccggccgaaaggtggg
tccggggacaccctggctccccagtga

DBGET integrated database retrieval system