KEGG   Homo sapiens (human): 81567Help
Entry
81567             CDS       T01001                                 

Gene name
TXNDC5, ENDOPDI, ERP46, HCC-2, HCC2, PDIA15, STRF8, UNQ364
Definition
(RefSeq) thioredoxin domain containing 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81567 (TXNDC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    81567 (TXNDC5)
   04131 Membrane trafficking [BR:hsa04131]
    81567 (TXNDC5)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   81567 (TXNDC5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    81567 (TXNDC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_7 HyaE
Motif
Other DBs
NCBI-GeneID: 81567
NCBI-ProteinID: NP_110437
OMIM: 616412
HGNC: 21073
Ensembl: ENSG00000239264
Vega: OTTHUMG00000014216
Pharos: Q8NBS9(Tbio)
UniProt: Q8NBS9
Structure
PDB: 

Position
6p24.3
AA seq 432 aa AA seqDB search
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcgcccaggacgcctcctcccgctgctggcccggccggcggccctgactgcg
ctgctgctgctgctgctgggccatggcggcggcgggcgctggggcgcccgggcccaggag
gcggcggcggcggcggcggacgggccccccgcggcagacggcgaggacggacaggacccg
cacagcaagcacctgtacacggccgacatgttcacgcacgggatccagagcgccgcgcac
ttcgtcatgttcttcgcgccctggtgtggacactgccagcggctgcagccgacttggaat
gacctgggagacaaatacaacagcatggaagatgccaaagtctatgtggctaaagtggac
tgcacggcccactccgacgtgtgctccgcccagggggtgcgaggataccccaccttaaag
cttttcaagccaggccaagaagctgtgaagtaccagggtcctcgggacttccagacactg
gaaaactggatgctgcagacactgaacgaggagccagtgacaccagagccggaagtggaa
ccgcccagtgcccccgagctcaagcaagggctgtatgagctctcagcaagcaactttgag
ctgcacgttgcacaaggcgaccactttatcaagttcttcgctccgtggtgtggtcactgc
aaagccctggctccaacctgggagcagctggctctgggccttgaacattccgaaactgtc
aagattggcaaggttgattgtacacagcactatgaactctgctccggaaaccaggttcgt
ggctatcccactcttctctggttccgagatgggaaaaaggtggatcagtacaagggaaag
cgggatttggagtcactgagggagtacgtggagtcgcagctgcagcgcacagagactgga
gcgacggagaccgtcacgccctcagaggccccggtgctggcagctgagcccgaggctgac
aagggcactgtgttggcactcactgaaaataacttcgatgacaccattgcagaaggaata
accttcatcaagttttatgctccatggtgtggtcattgtaagactctggctcctacttgg
gaggaactctctaaaaaggaattccctggtctggcgggggtcaagatcgccgaagtagac
tgcactgctgaacggaatatctgcagcaagtattcggtacgaggctaccccacgttattg
cttttccgaggagggaagaaagtcagtgagcacagtggaggcagagaccttgactcgtta
caccgctttgtcctgagccaagcgaaagacgaactttag

DBGET integrated database retrieval system