KEGG   Homo sapiens (human): 81570Help
Entry
81570             CDS       T01001                                 

Gene name
CLPB, ANKCLB, HSP78, MEGCANN, MGCA7, SKD3
Definition
(RefSeq) caseinolytic mitochondrial matrix peptidase chaperone subunit B
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04213  Longevity regulating pathway - multiple species
Disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    81570 (CLPB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    81570 (CLPB)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP100
   81570 (CLPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_2 Ank_2 Ank Ank_5 Ank_3 Ank_4 ClpB_D2-small AAA_5 AAA Sigma54_activat Zeta_toxin AAA_16 Torsin AAA_22 AAA_3 AAA_24 YchF-GTPase_C ABC_tran ATPase_2 RP853
Motif
Other DBs
NCBI-GeneID: 81570
NCBI-ProteinID: NP_110440
OMIM: 616254
HGNC: 30664
Ensembl: ENSG00000162129
Vega: OTTHUMG00000167902
Pharos: Q9H078(Tbio)
UniProt: Q9H078 A0A140VK11
Position
11q13.4
AA seq 707 aa AA seqDB search
MLGSLVLRRKALAPRLLLRLLRSPTLRGHGGASGRNVTTGSLGEPQWLRVATGGRPGTSP
ALFSGRGAATGGRQGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAA
ALVVHCYSKSPSNKDAALLEAARANNMQEVSRLLSEGADVNAKHRLGWTALMVAAINRNN
SVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHSLEDGGQDGASRHITNQWTSALEFRRWL
GLPAGVLITREDDFNNRLNNRASFKGCTALHYAVLADDYRTVKELLDGGANPLQRNEMGH
TPLDYAREGEVMKLLRTSEAKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVGAA
IRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEV
AKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGK
GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNF
KENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLL
WDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAAAYEQDLLPGGCTLRITVEDSDKQL
LKSPELPSPQAEKRLPKLRLEIIDKDSKTRRLDIRAPLHPEKVCNTI
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgctggggtccctggtgttgaggagaaaagcactggcgccacggctactcctccggctg
ctcaggtccccaacgctccggggccatggaggtgcttccggccggaatgtgactactggg
agtctcggggagccgcagtggctgagggtagccaccggggggcgccctggaacatcgccg
gccttgttctccggacgtggggcagccaccggggggcgccagggaggacgcttcgatacc
aaatgcctcgcggctgccacttggggacgccttcctggtcccgaagaaacactcccagga
caggacagctggaacggggtccccagcagggccggactgggcatgtgcgccctggccgca
gcgctggtggttcattgctacagcaagagtccgtccaacaaggatgcagccctgttggaa
gctgcccgtgccaacaatatgcaagaagtcagcaggctgttgtcagaaggtgcagatgtc
aatgcaaagcacagacttggctggacagcactcatggtggcagccatcaaccgaaacaac
agtgtggtacaggtcctgcttgctgctggggctgatccaaaccttggagatgatttcagc
agtgtttacaagactgccaaggaacagggaatccattctttggaagatgggggacaggac
ggtgcaagccggcacatcacaaaccagtggacaagtgccctggagttcaggagatggcta
ggactccccgctggcgtcctgatcacccgagaggatgacttcaacaacaggctgaacaac
cgcgccagtttcaagggctgcacggccttgcactatgctgttcttgctgatgactaccgc
actgtcaaggagctgcttgatggaggagccaaccccctgcagaggaatgaaatgggacac
acacccttggattatgcccgagaaggggaagtgatgaagcttctgaggacttctgaagcc
aagtaccaagagaagcagcggaagcgtgaggctgaggagcggcgccgcttccccctggag
cagcgactaaaggagcacatcattggccaggagagcgccatcgccacagtgggtgctgcg
atccggaggaaggagaatggctggtacgatgaagaacaccctctggtcttcctcttcttg
ggatcatctggaataggaaaaacagagctggccaagcagacagccaaatatatgcacaaa
gatgctaaaaagggcttcatcaggctggacatgtccgagttccaggagcgacacgaggtg
gccaagtttattgggtctccaccaggctacgttggccatgaggagggtggccagctgacc
aagaagttgaagcagtgccccaatgctgtggtgctctttgatgaagtagacaaggcccat
ccagatgtgctcaccatcatgctgcagctgtttgatgagggccggctgacagatggaaaa
gggaagaccattgattgcaaggacgccatcttcatcatgacctccaatgtggccagcgac
gagatcgcacagcacgcgctgcagctgaggcaggaagctttggagatgagccgtaaccgt
attgccgaaaacctgggggatgtccagataagtgacaagatcaccatctcaaagaacttc
aaggagaatgtgattcgccctatcctgaaagctcacttccggagggatgagtttctggga
cggatcaatgagatcgtctacttcctccccttctgccactcggagctcatccaactcgtc
aacaaggaactaaacttctgggccaagagagccaagcaaaggcacaacatcacgctgctc
tgggaccgcgaggtggcagatgtgctggtcgacggctacaatgtgcactatggcgcccgc
tccatcaaacatgaggtagaacgccgtgtggtgaaccagctggcagcagcctatgagcag
gacctgctgccagggggctgtactttgcgcatcacggtggaggactcagacaagcagcta
ctcaaaagcccagaactgccctcaccccaggctgagaagcgcctccccaagctgcgtctg
gagatcatcgacaaggacagcaagactcgcagactggacatccgggcaccactgcaccct
gagaaggtgtgcaacaccatctag

DBGET integrated database retrieval system