KEGG   Homo sapiens (human): 81575Help
Entry
81575             CDS       T01001                                 

Gene name
APOLD1, VERGE
Definition
(RefSeq) apolipoprotein L domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL Amj Prefoldin BLOC1_2
Motif
Other DBs
NCBI-GeneID: 81575
NCBI-ProteinID: NP_001123887
OMIM: 612456
HGNC: 25268
Ensembl: ENSG00000178878
Vega: OTTHUMG00000153561
Pharos: Q96LR9(Tdark)
UniProt: Q96LR9
Position
12p13.1
AA seq 279 aa AA seqDB search
MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRG
RLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSA
VGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGD
RQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESC
TGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgcgccgtgtcaccggctgcgggccaggggtactcggaaggcgcgggcagga
gcctggcgaggatgcaccttcccctgccttggaaagggaatggagaggccggcggcccgg
gagccgcatgggcccgacgcgctgcggcgcttccagggactgctgctggaccgccgaggc
cggctgcacggccaggtgctgcgcctgcgcgaggtggcccggcgcctggagcgcctgcgc
aggcgctccctcgtagccaacgtggccggcagctcgctgagcgcaacgggcgccctcgcc
gccatcgtggggctctcgctcagcccggtcaccctggggacctcgctgctggtgtcggcc
gtggggctgggggtggccacagccggaggggccgtcaccatcacgtccgatctctcgctg
atcttctgcaactcccgggagctgcggagggtgcaggagatcgcggccacctgccaggac
cagatgcgagagatcctgagctgcctcgagtttttctgccgctggcagggctgcggggac
cgccagctgctgcagtgcgggaggaacgcctccatcgccctgtacaattctgtctacttc
atcgtcttctttggctcacgtggcttcctcatccccaggcgggcggagggggacaccaag
gttagccaggccgtgctgaaggccaagattcagaaactggccgagagcctggagtcctgc
accggggctctggacgaactcagcgagcagctggagtctcgggttcagctctgcaccaag
tccagtcgtggccacgacctcaagatctctgctgaccagcgtgcagggctgtttttctga

DBGET integrated database retrieval system