KEGG   Homo sapiens (human): 81577
Entry
81577             CDS       T01001                                 

Gene name
GFOD2
Definition
(RefSeq) glucose-fructose oxidoreductase domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C F420_oxidored Shikimate_DH PDH
Other DBs
NCBI-GeneID: 81577
NCBI-ProteinID: NP_110446
HGNC: 28159
Ensembl: ENSG00000141098
Vega: OTTHUMG00000137537
Pharos: Q3B7J2(Tdark)
UniProt: Q3B7J2
Position
16q22.1
AA seq 385 aa
MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDI
LLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLV
GNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGT
YIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLN
FNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVP
LLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEW
EAVEVLTEEPDTNQNLCEALQRNNL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaagatgctgccaggagtgggcgtgtttgggactggcagctccgcccgagttctggtc
ccactgctgagggcagaagggttcactgttgaggccctgtgggggaagactgaggaggag
gcgaagcagcttgctgaggagatgaacatcgccttctacaccagccggactgatgacatc
ttgctgcatcaagatgtggatctggtgtgcatcagcatcccccctccactcacccggcag
atatccgtgaaggctctaggtattgggaagaatgtggtttgcgagaaggcagcaacatcg
gtggatgccttccggatggtgacagcctcgcgctactacccgcagctcatgagcctggta
gggaacgtgctgcgcttcctgcctgccttcgtgcgcatgaaacagctgatttcggaacac
tatgtgggagcggtgatgatctgtgatgcccgcatctactcaggcagcctgctgagcccc
agctatggctggatctgtgatgagctcatgggcggcgggggcttgcacaccatggggacc
tacattgtggacctgctgacccacctgaccggccggagagccgagaaggtgcacgggctg
ctcaagacattcgtgaggcagaacgctgccatccgtggcatccggcacgtcactagcgat
gacttctgtttcttccagatgctcatgggtgggggtgtgtgtagcacagtgacactcaac
ttcaacatgccaggcgcctttgtgcatgaagtcatggtggtaggctctgcaggacgcctc
gtcgcccggggagccgacctctatgggcagaagaactctgccacgcaagaggagctgctc
ttgagggactcgctggcagtgggcgcaggactgcctgagcaggggccccaggatgtcccg
ctgctgtacctgaagggcatggtctacatggtgcaggccttgcgccagtccttccagggg
cagggcgaccgccgcacctgggaccgcacccctgtctccatggccgcctccttcgaggat
gggctgtacatgcagagcgtggtggatgccatcaagaggtcgagccgatccggggagtgg
gaggctgtggaggtgctgacggaggagcccgacaccaaccagaacctgtgtgaggcactt
cagcggaacaacctatga

DBGET integrated database retrieval system