KEGG   Homo sapiens (human): 81578Help
Entry
81578             CDS       T01001                                 

Gene name
COL21A1, COLA1L, FP633
Definition
(RefSeq) collagen type XXI alpha 1 chain
  KO
K16629  collagen, type XXI, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    81578 (COL21A1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    81578 (COL21A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen VWA VWA_2 VWA_3 Laminin_G_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 81578
NCBI-ProteinID: NP_001305680
OMIM: 610002
HGNC: 17025
Ensembl: ENSG00000124749
Vega: OTTHUMG00000014907
Pharos: Q96P44(Tbio)
UniProt: Q96P44 B7ZLK3 A0A158RFW1
Position
6p12.1; 6p12.3-p11.2
AA seq 957 aa AA seqDB search
MAHYITFLCMVLVLLLQNSVLAEDGEVRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDERGFDILLGLDVN
KKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRI
LTIDGRPQIAVTLNGVDKILLFTTTSVINGSQVVTFANPQVKTLFDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPVLGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFNGECLNGPSDVGSTPAPCICPPGKPGLQGPKGDPGLPGNPGYPGQPGQDGKPGY
QGIAGTPGVPGSPGIQGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGD
KGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGT
RGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGE
PGIQGMPGASGLKGEPGATGSPGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGI
PGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGPKGQPGDPGPQGPPGL
DGKPGREFSEQFIRQVCTDVIRAQLPVLLQSGRIRNCDHCLSQHGSPGIPGPPGPIGPEG
PRGLPGLPGRDGVPGLVGVPGRPGVRGLKGLPGRNGEKGSQGFGYPGEQGPPGPPGPEGP
PGISKEGPPGDPGLPGKDGDHGKPGIQGQPGPPGICDPSLCFSVIARRDPFRKGPNY
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggctcactatattacatttctctgcatggttttggtgctgcttcttcagaattctgtg
ttagctgaagatggggaagtaagatcaagttgtcgtactgctccgacagatttagttttc
atcttagatggctcttatagtgttggcccagaaaactttgaaatagtgaaaaagtggctt
gtcaatatcacaaaaaactttgacatagggccgaagtttattcaagttggagtggttcaa
tatagtgactaccctgtgctggagattcctctcggaagctatgattcaggagaacatttg
acggcagcagtggaatccatactctacttaggaggaaacacaaagacagggaaggccatc
cagtttgcgctcgattacctttttgccaagtcctcacgatttctgactaagatagcagtg
gtacttacggatggcaaatcccaagatgacgtcaaggatgcagctcaagcagcaagagat
agtaagataacattatttgctattggtgttggttcagaaacagaagatgccgaacttaga
gctattgccaacaagccttcgtctacttatgtgttttatgtggaagactatattgcaata
tccaaaataagggaagtgatgaagcagaaactttgtgaagaatctgtctgtccaacacga
attccagtggcagctcgtgatgaaaggggatttgatattcttttaggtttagatgtaaat
aaaaaggttaagaaaagaatacagctttcaccaaaaaagataaaaggatatgaagtaaca
tcaaaagttgatttatcagaactcacaagcaatgttttcccagaaggtcttcctccatca
tatgtatttgtgtctactcaaagatttaaagtcaagaaaatttgggatttatggagaata
ttaactattgatggaaggccacaaatagcagttaccttaaatggtgtggacaaaatctta
ttatttacaacaaccagcgtaattaatggctcacaagtggttacctttgctaaccctcaa
gttaagacgttgtttgatgaaggctggcaccaaattcgtctcttagtaacagaacaagat
gtgactttgtatattgatgaccaacaaattgaaaacaagcccttacatccagttttaggg
atcttgatcaatgggcaaacccaaattggaaaatattctggaaaagaagaaactgttcag
tttgatgtccaaaagttgcgaatctactgtgacccagaacagaacaaccgggagacagca
tgtgagattcctggatttaatggagagtgccttaatggtcccagtgatgtaggttcaact
ccagctccctgtatttgtcctccgggaaaaccaggacttcaaggccccaaaggtgaccct
ggactgcctgggaaccctggctaccctggacaacctggtcaagatggtaagcctggatat
cagggaattgcagggacaccaggtgttccaggatctccaggaatacaaggagctcgagga
ctaccaggttacaaaggagaaccagggcgagatggtgacaagggtgatcgtggacttcct
ggttttcctgggcttcatggcatgccaggatcaaagggtgaaatgggtgccaaaggagac
aaaggatcacctggattttatggcaaaaagggtgcaaaaggtgaaaaggggaatgctggc
ttccctggcctccctggacctgctggagaaccaggaagacatggaaaggatggattaatg
ggtagtcccggtttcaagggagaagcaggatcccctggtgctccggggcaggatggaaca
cggggagagcctggaatcccaggatttcctggaaaccgaggattaatgggccaaaaggga
gaaattgggcctccaggacagcaaggaaaaaaaggagccccagggatgcctggtttaatg
ggaagcaatggctcaccaggccagcctggaacaccgggatctaagggaagcaaaggtgaa
cctggaattcaagggatgcctggggcttctgggctcaagggagaaccaggagcaacgggt
tccccaggagaaccaggatacatgggtttacccgggattcaaggaaaaaagggggacaaa
ggaaatcaaggtgaaaaaggtattcagggtcaaaagggagaaaatggaagacagggaatt
ccagggcaacagggaattcaaggccatcatggtgcaaaaggagagagaggtgaaaaggga
gaacctggtgtccgaggtgccattggatcaaaaggagaatctggggtggatggcttgatg
gggcccgcaggtcctaaggggcaacctggggatccaggtcctcagggacccccaggtttg
gatgggaagcccggaagagagttttcagaacaatttattcgacaagtttgcacagatgta
ataagagcccagctaccagtcttacttcagagtggaagaattagaaattgtgatcattgc
ctgtcccaacatggctccccgggtattcctgggccacctggtccgataggcccagagggt
cccagaggattacctggtttgccaggaagagatggtgttcctggattagtgggtgtccct
ggacgtccaggtgtcagaggattaaaaggcctaccaggaagaaatggggaaaaagggagc
caagggtttgggtatcctggagaacaaggtcctcctggtcccccaggtccagagggccct
cctggaataagcaaagaaggtcctccaggagacccaggtctccctggcaaagatggagac
catggaaaacctggaatccaagggcaaccaggccccccaggcatctgcgacccatcacta
tgttttagtgtaattgccagaagagatccgttcagaaaaggaccaaactattag

DBGET integrated database retrieval system