KEGG   Homo sapiens (human): 81579Help
Entry
81579             CDS       T01001                                 

Gene name
PLA2G12A, GXII, PLA2G12, ROSSY
Definition
(RefSeq) phospholipase A2 group XIIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    81579 (PLA2G12A)
   00565 Ether lipid metabolism
    81579 (PLA2G12A)
   00590 Arachidonic acid metabolism
    81579 (PLA2G12A)
   00591 Linoleic acid metabolism
    81579 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    81579 (PLA2G12A)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    81579 (PLA2G12A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    81579 (PLA2G12A)
  Digestive system
   04972 Pancreatic secretion
    81579 (PLA2G12A)
   04975 Fat digestion and absorption
    81579 (PLA2G12A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     81579 (PLA2G12A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    81579 (PLA2G12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2G12
Motif
Other DBs
NCBI-GeneID: 81579
NCBI-ProteinID: NP_110448
OMIM: 611652
HGNC: 18554
Ensembl: ENSG00000123739
Vega: OTTHUMG00000131915
Pharos: Q9BZM1(Tbio)
UniProt: Q9BZM1 Q542Y6
Position
4q25
AA seq 189 aa AA seqDB search
MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGED
GLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKS
KNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACR
CHYEEKTDL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctctcgcgccccgcgctcaccctcctgctcctcctcatggccgctgttgtc
aggtgccaggagcaggcccagaccaccgactggagagccaccctgaagaccatccggaac
ggcgttcataagatagacacgtacctgaacgccgccttggacctcctgggaggcgaggac
ggtctctgccagtataaatgcagtgacggatctaagcctttcccacgttatggttataaa
ccctccccaccgaatggatgtggctctccactgtttggtgttcatcttaacattggtatc
ccttccctgacaaagtgttgcaaccaacacgacaggtgctatgagacctgtggcaaaagc
aagaatgactgtgatgaagaattccagtattgcctctccaagatctgccgagatgtacag
aaaacactaggactaactcagcatgttcaggcatgtgaaacaacagtggagctcttgttt
gacagtgttatacatttaggttgtaaaccatatctggacagccaacgagccgcatgcagg
tgtcattatgaagaaaaaactgatctttaa

DBGET integrated database retrieval system