KEGG   Homo sapiens (human): 816Help
Entry
816               CDS       T01001                                 

Gene name
CAMK2B, CAM2, CAMK2, CAMKB, MRD54
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04114  Oocyte meiosis
hsa04217  Necroptosis
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04934  Cushing's syndrome
hsa04971  Gastric acid secretion
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
Network
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    816 (CAMK2B)
   04310 Wnt signaling pathway
    816 (CAMK2B)
   04066 HIF-1 signaling pathway
    816 (CAMK2B)
   04020 Calcium signaling pathway
    816 (CAMK2B)
   04024 cAMP signaling pathway
    816 (CAMK2B)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    816 (CAMK2B)
   04217 Necroptosis
    816 (CAMK2B)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    816 (CAMK2B)
   04922 Glucagon signaling pathway
    816 (CAMK2B)
   04912 GnRH signaling pathway
    816 (CAMK2B)
   04921 Oxytocin signaling pathway
    816 (CAMK2B)
   04916 Melanogenesis
    816 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    816 (CAMK2B)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    816 (CAMK2B)
  Digestive system
   04971 Gastric acid secretion
    816 (CAMK2B)
  Nervous system
   04725 Cholinergic synapse
    816 (CAMK2B)
   04728 Dopaminergic synapse
    816 (CAMK2B)
   04720 Long-term potentiation
    816 (CAMK2B)
   04722 Neurotrophin signaling pathway
    816 (CAMK2B)
  Sensory system
   04740 Olfactory transduction
    816 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    816 (CAMK2B)
  Development
   04360 Axon guidance
    816 (CAMK2B)
  Environmental adaptation
   04713 Circadian entrainment
    816 (CAMK2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    816 (CAMK2B)
   05205 Proteoglycans in cancer
    816 (CAMK2B)
   05214 Glioma
    816 (CAMK2B)
  Substance dependence
   05031 Amphetamine addiction
    816 (CAMK2B)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    816 (CAMK2B)
  Infectious diseases
   05152 Tuberculosis
    816 (CAMK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     816 (CAMK2B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   816 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2 Kdo SnoaL_4
Motif
Other DBs
NCBI-GeneID: 816
NCBI-ProteinID: NP_001211
OMIM: 607707
HGNC: 1461
Ensembl: ENSG00000058404
Vega: OTTHUMG00000023491
Pharos: Q13554(Tchem)
UniProt: Q13554 A4D2J9
Structure
PDB: 

Position
7p13
AA seq 666 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagcgaggctgatgccagtcactgtatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgcttctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggccta
gctatcgaggtgcagggggaccagcaggcatggtttggtttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcctgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggtgcctatgacttcccgtcccctgagtgggacacc
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcatcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaatacc
accatagaggatgaagacgctaaagcccccagggtccccgacatcctgagctcagtgagg
aggggctcgggagccccagaagccgaggggcccctgccctgcccatctccggctcccttt
agccccctgccagccccatcccccaggatctctgacatcctgaactctgtgagaaggggt
tcaggaaccccagaagccgagggccccctctcagcggggcccccgccctgcctgtctccg
gctctcctaggccccctgtcctccccgtcccccaggatctctgacatcctgaactctgtg
aggaggggctcagggaccccagaagccgagggcccctcgccagtggggcccccgccctgc
ccatctccgactatccctggccccctgcccaccccatcccggaagcaggagatcattaag
accacggagcagctcatcgaggccgtcaacaacggtgactttgaggcctacgcgaaaatc
tgtgacccagggctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatg
gacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacg
accatcctgaacccacacgtgcacgtcattggagaggatgccgcctgcatcgcttacatc
cggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggagacc
cgcgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggcgcg
cctgtggccccgctgcagtga

DBGET integrated database retrieval system