KEGG   Homo sapiens (human): 81602Help
Entry
81602             CDS       T01001                                 

Gene name
CDADC1, NYD-SP15, bA103J18.1
Definition
(RefSeq) cytidine and dCMP deaminase domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam SNAD4
Motif
Other DBs
NCBI-GeneID: 81602
NCBI-ProteinID: NP_112173
HGNC: 20299
Ensembl: ENSG00000102543
Vega: OTTHUMG00000016913
Pharos: Q9BWV3(Tdark)
UniProt: Q9BWV3
Position
13q14.2
AA seq 514 aa AA seqDB search
MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQK
NEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGS
RLKNCDLYFSRKPCSACLKMIVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERL
KSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANTDFYYECKQERIKEYE
MLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLILLLATVASSVPNFKHFGFYR
SNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMY
FVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF
VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYG
LEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagctgggcagatgcaaaatctggagagcgcgagggccgggcggtcagtcagc
acccagactggcagcatgaccggtcagataccaaggctttctaaagtcaaccttttcact
ctgctcagcctctggatggagctctttccagcagaagcccagcggcaaaaatctcagaaa
aatgaagagggaaagcatggacccttaggagataatgaagagaggaccagagtatctact
gacaaaagacaggtaaagagaactggtcttgtggtggtgaaaaacatgaaaattgttggt
ctccactgttctagtgaagatttacatgccgggcagattgctcttattaaacatgggtca
aggctgaaaaactgtgatctttatttttccagaaaaccatgttctgcttgtttgaaaatg
attgtaaatgctggagttaaccgaatttcatactggcctgctgatccagaaataagtttg
cttacggaggcttctagttctgaagatgcaaagttagatgccaaagcagtggaaagattg
aagtcaaacagtcgggcccatgtgtgtgtcttacttcaacctttggtgtgttatatggtg
cagtttgtagaggagacctcttacaaatgtgactttattcaaaaaattacaaaaacattg
ccggatgctaacactgacttttattatgaatgtaaacaagaaagaataaaagaatatgaa
atgttatttttggtttcaaatgaagaaatgcataagcaaatactgatgactataggtttg
gagaacctgtgtgaaaatccatactttagcaatctaaggcaaaacatgaaagaccttatc
ctacttttggccacagtagcttccagtgtgccgaactttaaacacttcggattttaccgt
agcaatccagaacagattaatgaaattcacaatcaaagtttgccacaggaaattgcaagg
cactgcatggttcaggccaggttattggcatatcgaactgaggatcataaaacaggagtt
ggggcagtcatttgggcagaagggaaatctagaagttgtgatggaacaggtgccatgtac
tttgtaggatgtggttacaatgcttttcctgttggatctgagtatgctgacttcccacac
atggatgacaagcagaaagacagagaaataaggaaattcagatacatcatacatgcggaa
cagaatgccttgacatttaggtgtcaagaaataaaaccagaagaaagaagcatgattttt
gtgacaaagtgcccatgtgatgagtgtgtacctttaattaaaggtgcaggcataaaacaa
atctatgcaggagatgtagatgttggaaaaaagaaggcagacatctcttacatgaggttc
ggggagcttgaaggtgttagcaaatttacgtggcagctgaatccatcaggagcttatggt
cttgaacaaaatgagcctgaaaggagagaaaatggtgtgttgagacctgtcccacagaag
gaagagcagcaccaggacaagaagctgcgcctcggaatccactaa

DBGET integrated database retrieval system