KEGG   Homo sapiens (human): 81610Help
Entry
81610             CDS       T01001                                 

Gene name
FAM83D, C20orf129, CHICA, dJ616B8.3
Definition
(RefSeq) family with sequence similarity 83 member D
  KO
K16805  protein FAM83D
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    81610 (FAM83D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    81610 (FAM83D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAM83 PLDc_2
Motif
Other DBs
NCBI-GeneID: 81610
NCBI-ProteinID: NP_112181
OMIM: 618380
HGNC: 16122
Ensembl: ENSG00000101447
Vega: OTTHUMG00000032462
Pharos: Q9H4H8(Tdark)
UniProt: Q9H4H8
Position
20q11.23
AA seq 585 aa AA seqDB search
MALLSEGLDEVPAACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRERLARFL
NPDEVHAILRAAERPGEEGAAAAAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAF
YQGAYRGATRVETHFQPRGAGEGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQ
EICRKQGVAVYILLDQALLSQFLDMCMDLKVHPEQEKLMTVRTITGNIYYARSGTKIIGK
VHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVVEHFDLEFRILYAQSKPISPK
LLSHFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAEGKAERKP
HDCESSTVSEEDYFSSHRDELQSRKAIDAATQTEPGEEMPGLSVSEVGTQTSITTACAGT
QTAVITRIASSQTTIWSRSTTTQTDMDENILFPRGTQSTEGSPVSKMSVSRSSSLKSSSS
VSSQGSVASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRS
RLNHMLAMLSRRTLFTENHLGLHSGNFSRVNLLAVRDVALYPSYQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtccgagggcctggacgaggtgcccgccgcctgcctgtcgccgtgcggg
ccgcccaacccgaccgagctgttcagcgagtcacggcgcctggctctggaggagctggtg
gcgggcggccccgaagccttcgcggccttcctgcgacgcgagcgcctggctcgtttcctg
aaccccgatgaggtgcacgccattctgcgcgcggcggagaggccgggagaggagggcgcg
gcggcggcggcggcggccgaggactcgttcggctcctcgcacgactgctcttcgggcacc
tacttccccgagcagtcggacctggagccaccgctgttggagcttggctggcccgccttc
taccagggcgcctaccgcggcgccacgcgtgtcgagacgcacttccagccccgcggcgct
ggcgaaggtggcccctacggctgcaaggacgctctgcgccagcagctccgctcggcgcga
gaggtgattgcagtggtcatggacgtgttcacagacatcgacatcttcagagacctgcaa
gaaatatgcaggaaacagggagttgctgtgtatatccttctggaccaggctctcctctct
caatttctggatatgtgcatggatctgaaagttcatcctgaacaggaaaagttaatgaca
gttcggactatcacaggaaatatctactatgcaaggtcaggaactaagattattgggaag
gttcacgaaaagttcacgttgattgatggcatccgcgtggcaacaggctcctacagtttt
acatggacggatggcaaattaaacagcagtaacttggtaattctgtctggccaagtggtt
gaacactttgatctggagttccgaatcctgtatgcccagtccaagcccatcagccccaaa
ctcctgtctcacttccagagcagcaacaagtttgatcacctcaccaaccgaaaaccacag
tccaaggagctcaccctgggcaacctgctgcggatgcggctggctaggctgtcaagtact
cccaggaaggcggacctggacccagagatgcccgcagagggcaaggcagagcgcaagccc
catgactgtgagtcctctactgttagtgaggaagactacttcagcagccacagggacgag
ctccagagcagaaaggccattgacgctgccactcaaacagagccaggagaggagatgcca
gggctgagtgtgagtgaggtgggaacacaaaccagcatcaccacagcatgtgctggtacc
cagactgcagtcatcaccaggatagcaagctctcaaaccacgatttggtccagatcgacc
actactcagactgacatggatgagaacattctctttcctcgaggaactcaatctacagaa
gggtcaccagtctcaaaaatgtctgtatcgagatcttccagtttgaagtcttcctcctct
gtgtcttcccaaggctctgtggcaagctccactggttctcccgcttccatcagaaccact
gacttccacaatcctggctatcccaagtacctgggcaccccccacctggaactgtacttg
agtgactcacttagaaacttgaacaaagagcggcaattccacttcgctggtatcaggtcc
cggctcaaccacatgctggctatgctgtcaaggagaacactctttactgaaaaccacctt
ggccttcattctggcaatttcagcagagttaatttgcttgctgttagagatgtagcactt
tatccttcctatcagtaa

DBGET integrated database retrieval system